{ "uniprot_canonical_ac": "Q9R0N0-1", "uniprot_ac": "Q9R0N0", "uniprot_id": "GALK1_MOUSE", "mass": { "chemical_mass": 42295.0, "monoisotopic_mass": 42295.0 }, "refseq": { "ac": "NP_058601", "name": "galactokinase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058601" }, "gene_names": [ { "name": "Galk1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9R0N0", "id": "Q9R0N0" }, { "name": "GALK; Gk; Glk; Glk1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058601", "id": "NP_058601" }, { "name": "Galk1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058601", "id": "NP_058601" }, { "name": "Galk", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9R0N0", "id": "Q9R0N0" }, { "name": "Glk", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9R0N0", "id": "Q9R0N0" } ], "protein_names": [ { "name": "Galactokinase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9R0N0" }, { "name": "2.7.1.6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R0N0" }, { "name": "Galactose kinase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R0N0" }, { "name": "galactokinase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058601", "id": "NP_058601" }, { "name": "galactose kinase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058601", "id": "NP_058601" } ], "function": [ { "annotation": "Catalyzes the transfer of a phosphate from ATP to alpha-D-galactose and participates in the first committed step in the catabolism of galactose.", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0#function" }, { "database": "PubMed", "id": "10915771", "url": "https://glygen.org/publication/PubMed/10915771" } ] } ], "disease": [ { "disease_id": "DOID:14695", "recommended_name": { "id": "DOID:14695", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14695", "name": "galactokinase deficiency", "description": "A galactosemia that involves an accumulation of galactose and galactitol secondary to the decreased conversion of galactose to galactose-1-phosphate by galactokinase." }, "synonyms": [ { "id": "DOID:14695", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:14695", "name": "Galactosemia II", "description": "" }, { "id": "MONDO:0009255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009255", "name": "galactokinase deficiency", "description": "Galactokinase deficiency is a rare mild form of galactosemia characterized by early onset of cataract and an absence of the usual signs of classic galactosemia, i.e. feeding difficulties, poor weight gain and growth, lethargy, and jaundice." }, { "id": "MONDO:0009255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009255", "name": "GALK deficiency", "description": "" }, { "id": "MONDO:0009255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009255", "name": "GALK-D", "description": "" }, { "id": "MONDO:0009255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009255", "name": "galactokinase deficiency", "description": "" }, { "id": "MONDO:0009255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009255", "name": "galactokinase deficiency galactosemia", "description": "" }, { "id": "MONDO:0009255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009255", "name": "galactokinase deficiency with cataracts", "description": "" }, { "id": "MONDO:0009255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009255", "name": "galactosemia II", "description": "" }, { "id": "MONDO:0009255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009255", "name": "galactosemia type 2", "description": "" }, { "id": "MONDO:0009255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009255", "name": "Galk deficiency", "description": "" }, { "id": "MONDO:0009255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009255", "name": "galactosemia 2", "description": "" }, { "id": "MONDO:0009255", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009255", "name": "hereditary galactokinase deficiency", "description": "" }, { "id": "MIM:230200", "resource": "MIM", "url": "https://www.omim.org/entry/230200", "name": "Galactosemia 2", "description": "Galactosemia 2" } ], "evidence": [ { "id": "14695", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:14695" } ] }, { "disease_id": "DOID:83", "recommended_name": { "id": "DOID:83", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:83", "name": "cataract", "description": "A lens disease characterized by clouding of the lens inside the eye which leads to a decrease in vision." }, "synonyms": [ { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract 1 multiple types", "description": "Any cataract (disease) in which the cause of the disease is a mutation in the GJA8 gene." }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "CTRCT1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "Duffy linked cataract", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "GJA8 cataract (disease)", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract (disease) caused by mutation in GJA8", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract 1, multiple types, with or without microcornea", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "CAE1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "CZP1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "zonular pulverulent cataract 1", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract 1, multiple types", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract, Duffy-linked", "description": "" }, { "id": "MONDO:0007285", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007285", "name": "cataract, zonular pulverulent, 1", "description": "" }, { "id": "MONDO:0011060", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011060", "name": "early-onset non-syndromic cataract", "description": "Early-onset non-syndromic cataract is a rare, genetic, non-syndromic developmental defect of the eye, with high clinical and genetic heterogeneity, most frequently characterized by bilateral, symmetrical, non-progressive cataracts which present at birth or in early-childhood. Additional ocular manifestations (e.g. anterior segment dysgenesis, colobomas, nystagmus, microcornea, microphthalmia, myopia) may be associated, however other organs/systems are usually not affected." }, { "id": "MONDO:0011060", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011060", "name": "cataract, age-related nuclear", "description": "" }, { "id": "MONDO:0011060", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011060", "name": "nuclear sclerosis of the lens", "description": "" }, { "id": "MIM:116200", "resource": "MIM", "url": "https://www.omim.org/entry/116200", "name": "Cataract 1, multiple types", "description": "Cataract 1, multiple types" } ], "evidence": [ { "id": "83", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:83" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Galk1", "url": "https://www.uniprot.org/uniprot/Q9R0N0", "locus": { "chromosome": "11", "start_pos": 115899283, "end_pos": 115903545, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000020766", "url": "https://www.ensembl.org/id/ENSMUSG00000020766" } ] } } ], "crossref": [ { "id": "ENSMUSG00000020766", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000020766", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "14635", "url": "https://www.ncbi.nlm.nih.gov/gene/14635", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9R0N0", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9R0N0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000705", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000705", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006203", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006203", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006204", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006204", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006206", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006206", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013750", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013750", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014721", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014721", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019539", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019539", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019741", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019741", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020568", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020568", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036554", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036554", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:14635", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14635", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "95730", "url": "http://www.informatics.jax.org/marker/MGI:95730", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9R0N0", "url": "https://oglcnac.org/atlas/detail/Q9R0N0", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q9R0N0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R0N0", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "VMPCAIN", "url": "https://omabrowser.org/oma/group/VMPCAIN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "177392at2759", "url": "http://www.orthodb.org/?query=177392at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10457", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10457", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10457:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10457:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00288", "url": "http://pfam.xfam.org/family/PF00288", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08544", "url": "http://pfam.xfam.org/family/PF08544", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF10509", "url": "http://pfam.xfam.org/family/PF10509", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9R0N0", "url": "http://purl.obolibrary.org/obo/PR_Q9R0N0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-70370", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70370", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_058601", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_058601", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "13553", "url": "https://www.rhea-db.org/rhea/13553", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9R0N0-1", "url": "https://www.uniprot.org/uniprot/Q9R0N0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAWRPPRVEELLAEARRAFMEEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELVTVMVGSPRTDGLVSLLTTSKDADEPQRLQFPLPSAQWSLEPGIPQWANYVKGVIQHYPASPLVGFSAVVVSSVPLGGGLSSSASLEVATYTFIQQLCPDSGAIAARAQVCQRAEHSFAGVPCGIMDQLIALLGQKGYALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLGSSEYPVRRRQCEEVAQALGKESLREVRMEELEAGRELMSKEGFRRARHVVSEIRRTAQAAAAMSRGDYKAFGRLMVESHYSLRDDYEVSCPELDQLVEAALSVPGVYGSRMTGGGFGGCTVTLLEASVAPLVIDHIQEQYSGTATFYLSQAADGAQVLSL", "length": 392, "header": "sp|Q9R0N0-1|GALK1_MOUSE Isoform 1 of Galactokinase OS=Mus musculus OX=10090 GN=Galk1 PE=1 SV=2 CANONICAL=Q9R0N0-1" }, "isoforms": [ { "isoform_ac": "Q9R0N0-1", "url": "", "sequence": { "sequence": "MAAWRPPRVEELLAEARRAFMEEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELVTVMVGSPRTDGLVSLLTTSKDADEPQRLQFPLPSAQWSLEPGIPQWANYVKGVIQHYPASPLVGFSAVVVSSVPLGGGLSSSASLEVATYTFIQQLCPDSGAIAARAQVCQRAEHSFAGVPCGIMDQLIALLGQKGYALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLGSSEYPVRRRQCEEVAQALGKESLREVRMEELEAGRELMSKEGFRRARHVVSEIRRTAQAAAAMSRGDYKAFGRLMVESHYSLRDDYEVSCPELDQLVEAALSVPGVYGSRMTGGGFGGCTVTLLEASVAPLVIDHIQEQYSGTATFYLSQAADGAQVLSL", "length": 392, "header": "sp|Q9R0N0-1|GALK1_MOUSE Isoform 1 of Galactokinase OS=Mus musculus OX=10090 GN=Galk1 PE=1 SV=2 CANONICAL=Q9R0N0-1" }, "locus": { "chromosome": "11", "start_pos": 115903504, "end_pos": 115899472, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000021114", "url": "https://www.ensembl.org/id/ENSMUST00000021114" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000021114", "url": "https://www.ensembl.org/id/ENSMUSP00000021114" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 223, "start_aa": "Thr", "end_pos": 223, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr223", "evidence": [ { "id": "Q9R0N0", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R0N0" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "Q9R0N0", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9R0N0" } ] } ], "phosphorylation": [ { "start_pos": 230, "end_pos": 230, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "site_lbl": "Ser230" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A mouse model of galactose-induced cataracts.", "journal": "Hum. Mol. Genet.", "date": "2000", "authors": "Huang K., Zheng Z., Reynolds R., Stambolian D., Bernard D.J., Ai Y., Segal S., Ning C., O'Brien-Jenkins A., Wynshaw-Boris T.", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "reference": [ { "type": "PubMed", "id": "10915771", "url": "https://glygen.org/publication/PubMed/10915771" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9R0N0", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R0N0" }, { "database": "O-GlcNAc Atlas", "id": "Q9R0N0", "url": "https://oglcnac.org/atlas/detail/Q9R0N0" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] } ], "pathway": [ { "id": "mmu:14635", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:14635", "resource": "KEGG Pathway" }, { "id": "R-MMU-70370", "name": "Galactose catabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70370", "resource": "Reactome", "description": "Galactose catabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "P51570-1", "protein_name": "Galactokinase", "gene_name": "GALK1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL", "length": 392 }, "evidence": [ { "id": "45233238", "url": "http://www.informatics.jax.org/homology/45233238", "database": "MGI" }, { "id": "Q9R0N0", "url": "https://omabrowser.org/oma/group/Q9R0N0/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "galactitol metabolic process", "id": "GO:0019402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019402", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "pmid": "" }, { "name": "glycolytic process from galactose", "id": "GO:0061623", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061623", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "pmid": "" }, { "name": "galactose catabolic process via UDP-galactose", "id": "GO:0033499", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033499", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "pmid": "" }, { "name": "galactose metabolic process", "id": "GO:0006012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006012", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "pmid": "" }, { "name": "carbohydrate phosphorylation", "id": "GO:0046835", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046835", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "pmid": "" }, { "name": "galactokinase activity", "id": "GO:0004335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004335", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "pmid": "" }, { "name": "galactose binding", "id": "GO:0005534", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005534", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9R0N0", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "13553", "name": "", "equation": "alpha-D-galactose + ATP = ADP + alpha-D-galactose 1-phosphate + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P51570-1", "Q9R0N0-1", "P04385-1", "Q54DN6-1" ], "evidence": [ { "id": "13553", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/13553" } ] }, { "id": "R-MMU-70355", "name": "GALK1 phosphorylates Gal to Gal1P", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-29590" ], "output_participant_list": [ "R-ALL-30170" ], "enzyme_list": [ "Q9R0N0-1" ], "evidence": [ { "id": "R-MMU-70355", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70355" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-29590", "participant_name": "Gal [cytosol]", "crossref": [ { "id": "000100008403", "database": "ZINC", "url": "" }, { "id": "C00124", "database": "COMPOUND", "url": "" }, { "id": "8143700", "database": "PubChem Substance", "url": "" }, { "id": "17118", "database": "ChEBI", "url": "" }, { "id": "G93924TT", "database": "GlyTouCan", "url": "" }, { "id": "17118", "database": "ChEBI", "url": "" }, { "id": "G93924TT", "database": "GlyTouCan", "url": "" }, { "id": "8143700", "database": "PubChem Substance", "url": "" }, { "id": "000100008403", "database": "ZINC", "url": "" }, { "id": "C00124", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-30170", "participant_name": "Gal1P [cytosol]", "crossref": [ { "id": "C00446", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000645", "database": "HMDB Metabolite", "url": "" }, { "id": "8145198", "database": "PubChem Substance", "url": "" }, { "id": "000004096092", "database": "ZINC", "url": "" }, { "id": "17973", "database": "ChEBI", "url": "" }, { "id": "C00446", "database": "COMPOUND", "url": "" }, { "id": "17973", "database": "ChEBI", "url": "" }, { "id": "HMDB0000645", "database": "HMDB Metabolite", "url": "" }, { "id": "000004096092", "database": "ZINC", "url": "" }, { "id": "8145198", "database": "PubChem Substance", "url": "" }, { "id": "C00446", "database": "COMPOUND", "url": "" }, { "id": "17973", "database": "ChEBI", "url": "" }, { "id": "HMDB0000645", "database": "HMDB Metabolite", "url": "" }, { "id": "000004096092", "database": "ZINC", "url": "" }, { "id": "8145198", "database": "PubChem Substance", "url": "" }, { "id": "C00446", "database": "COMPOUND", "url": "" }, { "id": "HMDB0000645", "database": "HMDB Metabolite", "url": "" }, { "id": "8145198", "database": "PubChem Substance", "url": "" }, { "id": "000004096092", "database": "ZINC", "url": "" }, { "id": "17973", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "P04385", "gene_name": "GAL1", "activity": [ { "ec_number": "2.7.1.6", "activity": "alpha-D-galactose + ATP = ADP + alpha-D-galactose 1-phosphate + H(+).", "evidence": [ { "id": "P04385", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04385" } ] }, { "ec_number": "2.7.1.6", "activity": "", "evidence": [ { "id": "P04385", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04385" } ] } ] }, { "uniprot_ac": "P51570", "gene_name": "GALK1", "activity": [ { "ec_number": "2.7.1.6", "activity": "alpha-D-galactose + ATP = ADP + alpha-D-galactose 1-phosphate + H(+).", "evidence": [ { "id": "P51570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51570" } ] }, { "ec_number": "2.7.1.6", "activity": "", "evidence": [ { "id": "P51570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51570" } ] } ] }, { "uniprot_ac": "Q54DN6", "gene_name": "galK", "activity": [ { "ec_number": "2.7.1.6", "activity": "alpha-D-galactose + ATP = ADP + alpha-D-galactose 1-phosphate + H(+).", "evidence": [ { "id": "Q54DN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DN6" } ] }, { "ec_number": "2.7.1.6", "activity": "", "evidence": [ { "id": "Q54DN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54DN6" } ] } ] }, { "uniprot_ac": "Q9R0N0", "gene_name": "Galk1", "activity": [ { "ec_number": "2.7.1.6", "activity": "alpha-D-galactose + ATP = ADP + alpha-D-galactose 1-phosphate + H(+).", "evidence": [ { "id": "Q9R0N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ] }, { "ec_number": "2.7.1.6", "activity": "", "evidence": [ { "id": "Q9R0N0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R0N0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }