{ "uniprot_canonical_ac": "Q9R062-1", "uniprot_ac": "Q9R062", "uniprot_id": "GLYG_MOUSE", "mass": { "chemical_mass": 37402.0, "monoisotopic_mass": 37402.0 }, "refseq": { "ac": "NP_038783", "name": "glycogenin-1 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038783" }, "gene_names": [ { "name": "Gyg1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9R062", "id": "Q9R062" }, { "name": "Gyg", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9R062", "id": "Q9R062" }, { "name": "GN1; Gyg", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038783", "id": "NP_038783" }, { "name": "Gyg1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038783", "id": "NP_038783" }, { "name": "Gyg", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9R062", "id": "Q9R062" } ], "protein_names": [ { "name": "Glycogenin-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9R062" }, { "name": "2.4.1.186", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R062" }, { "name": "GN-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R062" }, { "name": "GN1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9R062" }, { "name": "glycogenin-1 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038783", "id": "NP_038783" }, { "name": "glycogenin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038783", "id": "NP_038783" } ], "function": [ { "annotation": "Injection of recombinant adeno-associated virus-1 vector expressing glycogen synthase short hairpin ribonucleic acids into mice with type II glycogen storage disease leads to significant reduction in impaired glycogen accumulation.", "evidence": [ { "database": "RefSeq", "id": "NP_038783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038783" }, { "database": "PubMed", "id": "18782850", "url": "https://glygen.org/publication/PubMed/18782850" } ] }, { "annotation": "Pulmonary glycogen deficiency as a new potential cause of respiratory distress syndrome.", "evidence": [ { "database": "RefSeq", "id": "NP_038783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038783" }, { "database": "PubMed", "id": "33219378", "url": "https://glygen.org/publication/PubMed/33219378" } ] }, { "annotation": "Self-glucosylates, via an inter-subunit mechanism, to form an oligosaccharide primer that serves as substrate for glycogen synthase.", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062#function" }, { "database": "UniProtKB", "id": "P46976", "url": "https://www.uniprot.org/uniprot/P46976#function" } ] } ], "disease": [ { "disease_id": "DOID:0050579", "recommended_name": { "id": "DOID:0050579", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050579", "name": "glycogen storage disease XV", "description": "A glycogen storage disease characterized by muscle weakness and cardiac abnormalities caused and has_material_basis_in mutation in the GYG1 gene that encodes glycogenin-1." }, "synonyms": [ { "id": "DOID:0050579", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050579", "name": "Glycogen storage disease 15", "description": "" }, { "id": "DOID:0050579", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050579", "name": "Glycogen storage disease with severe cardiomyopathy due to glycogenin deficiency", "description": "" }, { "id": "DOID:0050579", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050579", "name": "glycogen storage disease type XV", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "glycogen storage disease XV", "description": "Glycogen storage disease type 15 is an extremely rare genetic glycogen storage disease reported in one patient to date. Clinical signs included muscle weakness, cardiac arrhythmia associated with accumulation of abnormal storage material in the heart and glycogen depletion in skeletal muscle." }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "GSD type 15", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "GSD type XV", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "GSD with severe cardiomyopathy due to glycogenin deficiency", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "glycogen storage disease XV", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "glycogen storage disease type 15", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "glycogen storage disease type XV", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "glycogenosis type 15", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "glycogenosis type XV", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "glycogenosis with severe cardiomyopathy due to glycogenin deficiency", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "GSD 15", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "GSD15", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "Gyg1 deficiency", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "glycogen storage disease 15", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "glycogen storage disease with severe cardiomyopathy due to glycogenin deficiency", "description": "" }, { "id": "MONDO:0013291", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013291", "name": "glycogenin deficiency", "description": "" }, { "id": "MIM:613507", "resource": "MIM", "url": "https://www.omim.org/entry/613507", "name": "Glycogen storage disease 15", "description": "Glycogen storage disease 15" } ], "evidence": [ { "id": "0050579", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050579" } ] }, { "disease_id": "DOID:2747", "recommended_name": { "id": "DOID:2747", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2747", "name": "glycogen storage disease", "description": "A glycogen metabolism disorder that has_material_basis_in enzymes deficiencies necessary in the processing of glycogen synthesis or breakdown within muscles, liver, and other cell types." }, "synonyms": [ { "id": "DOID:2747", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2747", "name": "glycogenosis", "description": "" } ], "evidence": [ { "id": "2747", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:2747" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 305, "end_pos": 305, "sequence_org": "K", "sequence_mut": "A", "comment": "No loss of interaction with GYS2.", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" }, { "database": "PubMed", "id": "24982189", "url": "https://glygen.org/publication/PubMed/24982189" } ] }, { "start_pos": 308, "end_pos": 308, "sequence_org": "W", "sequence_mut": "A", "comment": "No loss of interaction with GYS2.", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" }, { "database": "PubMed", "id": "24982189", "url": "https://glygen.org/publication/PubMed/24982189" } ] }, { "start_pos": 315, "end_pos": 315, "sequence_org": "Y", "sequence_mut": "A", "comment": "Severe loss of interaction with GYS2.", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" }, { "database": "PubMed", "id": "24982189", "url": "https://glygen.org/publication/PubMed/24982189" } ] }, { "start_pos": 321, "end_pos": 321, "sequence_org": "F", "sequence_mut": "A", "comment": "Severe loss of interaction with GYS2.", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" }, { "database": "PubMed", "id": "24982189", "url": "https://glygen.org/publication/PubMed/24982189" } ] }, { "start_pos": 324, "end_pos": 324, "sequence_org": "I", "sequence_mut": "A", "comment": "Severe loss of interaction with GYS2.", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" }, { "database": "PubMed", "id": "24982189", "url": "https://glygen.org/publication/PubMed/24982189" } ] }, { "start_pos": 328, "end_pos": 328, "sequence_org": "L", "sequence_mut": "A", "comment": "Severe loss of interaction with GYS2.", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" }, { "database": "PubMed", "id": "24982189", "url": "https://glygen.org/publication/PubMed/24982189" } ] }, { "start_pos": 332, "end_pos": 332, "sequence_org": "L", "sequence_mut": "A", "comment": "No loss of interaction with GYS2.", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" }, { "database": "PubMed", "id": "24982189", "url": "https://glygen.org/publication/PubMed/24982189" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gyg1", "url": "https://www.uniprot.org/uniprot/Q9R062", "locus": { "chromosome": "3", "start_pos": 20176248, "end_pos": 20209481, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000019528", "url": "https://www.ensembl.org/id/ENSMUSG00000019528" } ] } } ], "crossref": [ { "id": "ENSMUSG00000019528", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000019528", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.4.1.186", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.186&UniProtAcc=Q9R062", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "GT8", "url": "http://www.cazy.org/GT8.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "cd02537", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02537", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "27357", "url": "https://www.ncbi.nlm.nih.gov/gene/27357", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "K3W4S6", "url": "https://www.ebi.ac.uk/intact/interactors/id:K3W4S6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "Q9R062", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9R062*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002495", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002495", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029044", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029044", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:27357", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:27357", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1351614", "url": "http://www.informatics.jax.org/marker/MGI:1351614", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9R062", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R062", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "NTFFNTW", "url": "https://omabrowser.org/oma/group/NTFFNTW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "306230at2759", "url": "http://www.orthodb.org/?query=306230at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11183", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11183", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11183:SF164", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11183:SF164", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01501", "url": "http://pfam.xfam.org/family/PF01501", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9R062", "url": "http://purl.obolibrary.org/obo/PR_Q9R062", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-3322077", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3322077", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-70221", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70221", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_038783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038783", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "23360", "url": "https://www.rhea-db.org/rhea/23360", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "56560", "url": "https://www.rhea-db.org/rhea/56560", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "K3W4S6", "url": "https://www.uniprot.org/uniprot/K3W4S6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K3W4S6-1", "url": "https://www.uniprot.org/uniprot/K3W4S6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9R062-1", "url": "https://www.uniprot.org/uniprot/Q9R062-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GX26", "url": "https://www.uniprot.org/uniprot/V9GX26", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GX26-1", "url": "https://www.uniprot.org/uniprot/V9GX26-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRMVVLTSPQVSDSMRKVLETVFDDVIMVDVLDSGDSAHLTLMKRPELGITLTKLHCWSLTQYSKCVFMDADTLVLSNIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSIETYNQLLHLASEQGSFDGGDQGLLNTYFSGWATTDITKHLPFVYNLSSISIYSYLPAFKAFGKNAKVVHFLGRTKPWNYTYNPQTKSVNCDSQDPTVSHPEFLNLWWDTFTTNVLPLLQHHGLVKDASSYLMMEHVSGALSDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ", "length": 333, "header": "sp|Q9R062-1|GLYG_MOUSE Isoform 1 of Glycogenin-1 OS=Mus musculus OX=10090 GN=Gyg1 PE=1 SV=3 CANONICAL=Q9R062-1" }, "isoforms": [ { "isoform_ac": "K3W4S6-1", "url": "", "sequence": { "sequence": "MRPGLEPARPRDGRYKSGGLRTPALPAGRGHLPAPGSSDPPGHTMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRMVVLTSPQVSDSMRKVLETVFDDVIMVDVLDSGDSAHLTLMKRPELGITLTKLHCWSLTQYSKCVFMDADTLVLSNIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSIETYNQLLHLASEQGSFDGGDQGLLNTYFSGWATTDITKHLPFVYNLSSISIYSYLPAFKAFGKNAKVVHFLGRTKPWNYTYNPQTKSVNCDSQDPTVSHPEFLNLWWDTFTTNVLPLLQHHGLVKDASSYLMMEHVSGALSDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ", "length": 377, "header": "tr|K3W4S6-1|GLYG_MOUSE Computationally mapped isoform of Glycogenin-1 OS=Mus musculus OX=10090 GN=Gyg1 PE=1 SV=1 CANONICAL=Q9R062-1" }, "locus": { "chromosome": "3", "start_pos": 20209300, "end_pos": 20176858, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000118015.9", "url": "https://www.ensembl.org/id/ENSMUST00000118015.9" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114019.3", "url": "https://www.ensembl.org/id/ENSMUSP00000114019.3" } ] } }, { "isoform_ac": "Q9R062-1", "url": "", "sequence": { "sequence": "MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRMVVLTSPQVSDSMRKVLETVFDDVIMVDVLDSGDSAHLTLMKRPELGITLTKLHCWSLTQYSKCVFMDADTLVLSNIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSIETYNQLLHLASEQGSFDGGDQGLLNTYFSGWATTDITKHLPFVYNLSSISIYSYLPAFKAFGKNAKVVHFLGRTKPWNYTYNPQTKSVNCDSQDPTVSHPEFLNLWWDTFTTNVLPLLQHHGLVKDASSYLMMEHVSGALSDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ", "length": 333, "header": "sp|Q9R062-1|GLYG_MOUSE Isoform 1 of Glycogenin-1 OS=Mus musculus OX=10090 GN=Gyg1 PE=1 SV=3 CANONICAL=Q9R062-1" }, "locus": { "chromosome": "3", "start_pos": 20209168, "end_pos": 20176858, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000178328", "url": "https://www.ensembl.org/id/ENSMUST00000178328" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000136035", "url": "https://www.ensembl.org/id/ENSMUSP00000136035" } ] } }, { "isoform_ac": "V9GX26-1", "url": "", "sequence": { "sequence": "XALPAGRGHLPAPGSSDPPGHTMTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRMVVLTSPQVSDSMRKVLETVFDDVIMVDVLDSGDSAHLTLMKRPELGITLTKLHCWSLTQYSKCVFMDADTLVLSNIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSIETYNQLLHLASEQGSFDGGDQGLLNTYFSGWATTDITKHLPFVYNLSSISIYSYLPAFKAFGKNAKVVHFLGRTKPWNYTYNPQTKSVNCDSQDPTVSHPEFLNLWWDTFTTNVLPLLQHHGLVKDASSYLMMLSDLVYTLAFSCGFCRKEHVSGALSDLSFGEAPAAPQPSMSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ", "length": 372, "header": "tr|V9GX26-1|GLYG_MOUSE Computationally mapped isoform of Glycogenin-1 OS=Mus musculus OX=10090 GN=Gyg1 PE=1 SV=1 CANONICAL=Q9R062-1" }, "locus": { "chromosome": "3", "start_pos": 20209233, "end_pos": 20176857, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000184552.2", "url": "https://www.ensembl.org/id/ENSMUST00000184552.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000138949.2", "url": "https://www.ensembl.org/id/ENSMUSP00000138949.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "site_category": "predicted", "site_seq": "Y", "relation": "attached", "comment": "O-linked (Glc...) tyrosine O-glucosylation", "start_pos": 195, "start_aa": "Tyr", "end_pos": 195, "end_aa": "Tyr", "residue": "Tyr", "site_lbl": "Tyr195", "evidence": [ { "id": "Q9R062", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R062#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q9R062", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R062" }, { "id": "36288343", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "phosphorylation": [ { "start_pos": 44, "end_pos": 44, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "site_lbl": "Ser44" } ], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Characterization of mouse glycogenin-1 cDNA and promoter region.", "journal": "Biochim. Biophys. Acta", "date": "1999", "authors": "Abraham L.J., Fournier P.A., Palmer T.N., van Maanen M.-H.", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "reference": [ { "type": "PubMed", "id": "10542328", "url": "https://glygen.org/publication/PubMed/10542328" } ] }, { "title": "Modulation of glycogen synthesis by RNA interference: towards a new therapeutic approach for glycogenosis type II.", "journal": "Human molecular genetics", "date": "2008", "authors": "Douillard-Guilloux G, Raben N, Takikita S, Batista L, Caillaud C, Richard E", "evidence": [ { "database": "RefSeq", "id": "NP_038783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038783" } ], "reference": [ { "type": "PubMed", "id": "18782850", "url": "https://glygen.org/publication/PubMed/18782850" } ] }, { "title": "Structural basis for the recruitment of glycogen synthase by glycogenin.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2014", "authors": "Zeqiraj E, Tang X, Hunter RW, Garcia-Rocha M, Judd A, Deak M, von Wilamowitz-Moellendorff A, Kurinov I, Guinovart JJ, Tyers M, Sakamoto K, Sicheri F", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "reference": [ { "type": "PubMed", "id": "24982189", "url": "https://glygen.org/publication/PubMed/24982189" } ] }, { "title": "Pulmonary glycogen deficiency as a new potential cause of respiratory distress syndrome.", "journal": "Human molecular genetics", "date": "2021", "authors": "Testoni G, Olmeda B, Duran J, Lopez-Rodriguez E, Aguilera M, Hernandez-Alvarez MI, Prats N, Perez-Gil J, Guinovart JJ", "evidence": [ { "database": "RefSeq", "id": "NP_038783", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038783" } ], "reference": [ { "type": "PubMed", "id": "33219378", "url": "https://glygen.org/publication/PubMed/33219378" } ] }, { "title": "First comprehensive identification of cardiac proteins with putative increased O-GlcNAc levels during pressure overload hypertrophy.", "journal": "PloS one", "date": "2022", "authors": "Zhu Wei Zhong, Palazzo Teresa, Zhou Mowei, Ledee Dolena, Olson Heather M, Pa\u0161a-Toli\u0107 Ljiljana, Olson Aaron K", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9R062", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9R062" } ], "reference": [ { "type": "PubMed", "id": "36288343", "url": "https://glygen.org/publication/PubMed/36288343" } ] } ], "pathway": [ { "id": "mmu:27357", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:27357", "resource": "KEGG Pathway" }, { "id": "R-MMU-3322077", "name": "Glycogen synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3322077", "resource": "Reactome", "description": "Glycogen synthesis" }, { "id": "R-MMU-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" }, { "id": "R-MMU-70221", "name": "Glycogen breakdown (glycogenolysis)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-70221", "resource": "Reactome", "description": "Glycogen breakdown (glycogenolysis)" } ], "orthologs": [ { "uniprot_canonical_ac": "O08730-1", "protein_name": "Glycogenin-1", "gene_name": "Gyg1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRTVVLASPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGITLTKLHCWSLTQYSKCVFMDADTLVLSNIDDLFEREELSAAPDPGWPDCFNSGVFVYQPSIETYNQLLHLASEQGSFDGGDQGLLNTYFSGWATTDITKHLPFVYNLSSLSIYSYLPAFKAFGKNAKVVHFLGRTKPWNYTYNPQTKSVKCESQDPIVSHPEFLNLWWDTFTTNVLPLLQHHGLVKDAGSYLMMEHVTGALSDLSFGEAPPASQPSLSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ", "length": 333 }, "evidence": [ { "id": "45232588", "url": "http://www.informatics.jax.org/homology/45232588", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P46976-1", "protein_name": "Glycogenin-1", "gene_name": "GYG1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTDQAFVTLTTNDAYAKGALVLGSSLKQHRTTRRLVVLATPQVSDSMRKVLETVFDEVIMVDVLDSGDSAHLTLMKRPELGVTLTKLHCWSLTQYSKCVFMDADTLVLANIDDLFDREELSAAPDPGWPDCFNSGVFVYQPSVETYNQLLHLASEQGSFDGGDQGILNTFFSSWATTDIRKHLPFIYNLSSISIYSYLPAFKVFGASAKVVHFLGRVKPWNYTYDPKTKSVKSEAHDPNMTHPEFLILWWNIFTTNVLPLLQQFGLVKDTCSYVNVLSDLVYTLAFSCGFCRKEDVSGAISHLSLGEIPAMAQPFVSSEERKERWEQGQADYMGADSFDNIKRKLDTYLQ", "length": 350 }, "evidence": [ { "id": "45232588", "url": "http://www.informatics.jax.org/homology/45232588", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 7, "go_terms": [ { "name": "glycogenin glucosyltransferase activity", "id": "GO:0008466", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008466", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "pmid": "" }, { "name": "UDP-alpha-D-glucose:glucosyl-glycogenin alpha-D-glucosyltransferase activity", "id": "GO:0102751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102751", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "pmid": "" }, { "name": "manganese ion binding", "id": "GO:0030145", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030145", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "pmid": "" }, { "name": "UDP-glycosyltransferase activity", "id": "GO:0008194", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008194", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "pmid": "" }, { "name": "glycosyltransferase activity", "id": "GO:0016757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016757", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "pmid": "" }, { "name": "glucose binding", "id": "GO:0005536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005536", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "glycogen biosynthetic process", "id": "GO:0005978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005978", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "pmid": "" }, { "name": "organic substance metabolic process", "id": "GO:0071704", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071704", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 188, "end_pos": 190, "annotation": "n_glycosylation_sequon" }, { "start_pos": 221, "end_pos": 223, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated.", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" }, { "database": "PubMed", "id": "P13280", "url": "https://glygen.org/publication/PubMed/P13280" } ] }, { "annotation": "Self-glycosylated by the transfer of glucose residues from UDP-glucose to itself, forming an alpha-1,4-glycan of around 10 residues attached to Tyr-195.", "evidence": [ { "database": "UniProtKB", "id": "Q9R062", "url": "https://www.uniprot.org/uniprot/Q9R062" }, { "database": "PubMed", "id": "P13280", "url": "https://glygen.org/publication/PubMed/P13280" } ] } ], "interactions": [], "reactions": [ { "id": "23360", "name": "", "equation": "L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = alpha-D-glucosyl-L-tyrosyl-[glycogenin] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08730-1", "O15488-1", "P46976-1", "Q9R062-1", "P47011-1", "P36143-1" ], "evidence": [ { "id": "23360", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/23360" } ] }, { "id": "56560", "name": "", "equation": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08730-1", "O15488-1", "P46976-1", "Q9R062-1", "P47011-1", "P36143-1" ], "evidence": [ { "id": "56560", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/56560" } ] }, { "id": "R-MMU-3322001", "name": "GYS1 catalyzes the polyglucosylation of oligoGlc-GYG1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R062-1", "Q9Z1E4-1" ], "evidence": [ { "id": "R-MMU-3322001", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3322001" } ] }, { "id": "R-MMU-3322003", "name": "Autoglucosylation of GYG1 complexed with GYS1-b", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R062-1", "Q9Z1E4-1" ], "evidence": [ { "id": "R-MMU-3322003", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3322003" } ] }, { "id": "R-MMU-3322005", "name": "GBE1 catalyzes branch formation in polyGlc-GYG1 complexed with GYS1-a", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R062-1", "Q9Z1E4-1", "Q9D6Y9-1" ], "evidence": [ { "id": "R-MMU-3322005", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3322005" } ] }, { "id": "R-MMU-3322025", "name": "Autoglucosylation of GYG1 complexed with GYS1-a", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R062-1", "Q9Z1E4-1" ], "evidence": [ { "id": "R-MMU-3322025", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3322025" } ] }, { "id": "R-MMU-3322041", "name": "Phosphorylated GYS1 catalyzes the polyglucosylation of oligoGlc-GYG1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R062-1", "Q9Z1E4-1" ], "evidence": [ { "id": "R-MMU-3322041", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3322041" } ] }, { "id": "R-MMU-3322057", "name": "GBE1 catalyzes branch formation in polyGlc-GYG1 complexed with GYS1-b", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R062-1", "Q9Z1E4-1", "Q9D6Y9-1" ], "evidence": [ { "id": "R-MMU-3322057", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3322057" } ] }, { "id": "R-MMU-3781018", "name": "EPM2A dimer dephosphorylates phosphoglycogen-GYG1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R062-1", "Q9Z1E4-1" ], "evidence": [ { "id": "R-MMU-3781018", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3781018" } ] }, { "id": "R-MMU-3781023", "name": "PPP1R3C binds to glycogen:GYG1:GYS1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R062-1", "Q9Z1E4-1" ], "evidence": [ { "id": "R-MMU-3781023", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3781023" } ] }, { "id": "R-MMU-3781024", "name": "GYS1 catalyzes the incorporation of phosphoglucose into glycogen-GYG1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R062-1", "Q9Z1E4-1" ], "evidence": [ { "id": "R-MMU-3781024", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-3781024" } ] }, { "id": "R-MMU-6798748", "name": "Exocytosis of secretory granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, secretory granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07901-1", "Q9DBJ1-1", "P70195-1", "P47811-1", "P58252-1", "Q9R062-1", "P17742-1", "Q91YP3-1", "Q8K183-1", "P63017-1", "Q7TMY8-1", "P50096-1", "P52480-1", "Q61206-1", "O35593-1", "P24270-1", "P06745-1", "P19157-1", "P12382-1", "Q9ET01-1", "P70335-1", "P10126-1", "Q01853-1", "P23475-1", "P27641-1", "Q62167-1", "P24547-1", "Q01768-1", "P48999-1", "P34884-1", "O08739-1", "P03953-1", "P08030-1", "P56389-1", "P10518-1", "O88844-1", "Q3TRM8-1", "P49290-1", "Q7TSV4-1", "P23492-1", "Q9QZH3-1", "P14234-1", "O08807-1", "P05063-1", "P05064-1", "Q9D8C9-1", "F8VPN4-1" ], "evidence": [ { "id": "R-MMU-6798748", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6798748" } ] }, { "id": "R-MMU-6800434", "name": "Exocytosis of ficolin-rich granule lumen proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "extracellular region, ficolin-1-rich granule lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07901-1", "Q9DBJ1-1", "P70195-1", "P47811-1", "P58252-1", "Q9R062-1", "P17742-1", "O35350-1", "Q8VCF1-1", "Q91YP3-1", "P63017-1", "Q7TMY8-1", "P50096-1", "P52480-1", "Q61206-1", "Q9D0F9-1", "Q91V92-1", "O35593-1", "P50429-1", "P24270-1", "P10605-1", "P06745-1", "P19157-1", "P12382-1", "Q9ET01-1", "P10126-1", "Q01853-1", "P23475-1", "Q62167-1", "O70370-1", "P09528-1", "P24547-1", "Q01768-1", "Q80UY2-1", "P48999-1", "Q69ZA1-1", "P34884-1", "O08739-1", "P03953-1", "P24527-1", "Q8R146-1", "P12265-1", "P23780-1", "P56389-1", "Q9WUU7-1", "P18242-1", "P10518-1", "O88844-1", "Q3TRM8-1", "P41245-1", "Q7TSV4-1", "P23492-1", "Q9QZH3-1", "Q9CYK2-1", "P63085-1", "O08807-1", "P05063-1", "P05064-1", "Q9WV54-1", "Q8BFR4-1", "Q9D8C9-1", "F8VPN4-1" ], "evidence": [ { "id": "R-MMU-6800434", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6800434" } ] }, { "id": "R-MMU-71552", "name": "limit dextrin-glycogenin => ((1,6)-alpha-glucosyl)poly((1,4)-alpha-glucosyl) glycogenin", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R062-1", "F8VPN4-1" ], "evidence": [ { "id": "R-MMU-71552", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-71552" } ] }, { "id": "R-MMU-71593", "name": "((1,6)-alpha-glucosyl)poly((1,4)-alpha-glucosyl)glycogenin => poly{(1,4)-alpha-glucosyl} glycogenin + alpha-D-glucose", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9R062-1", "F8VPN4-1" ], "evidence": [ { "id": "R-MMU-71593", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-71593" } ] }, { "id": "R-MMU-9036727", "name": "GAA hydrolyzes lysosomal glycogen", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P70699-1", "Q9R062-1" ], "evidence": [ { "id": "R-MMU-9036727", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9036727" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "F8VPN4", "gene_name": "Agl", "activity": [ { "ec_number": "2.4.1.25", "activity": "Transfers a segment of a (1->4)-alpha-D-glucan to a new position in an acceptor, which may be glucose or a (1->4)-alpha-D-glucan.", "evidence": [ { "id": "F8VPN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F8VPN4" } ] }, { "ec_number": "3.2.1.33", "activity": "Hydrolysis of (1->6)-alpha-D-glucosidic branch linkages in glycogen phosphorylase limit dextrin.", "evidence": [ { "id": "F8VPN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F8VPN4" } ] }, { "ec_number": "2.4.1.25", "activity": "", "evidence": [ { "id": "F8VPN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F8VPN4" } ] }, { "ec_number": "3.2.1.33", "activity": "", "evidence": [ { "id": "F8VPN4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F8VPN4" } ] } ] }, { "uniprot_ac": "O08730", "gene_name": "Gyg1", "activity": [ { "ec_number": "2.4.1.186", "activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.", "evidence": [ { "id": "O08730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08730" } ] }, { "ec_number": "2.4.1.186", "activity": "", "evidence": [ { "id": "O08730", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08730" } ] } ] }, { "uniprot_ac": "O08739", "gene_name": "Ampd3", "activity": [ { "ec_number": "3.5.4.6", "activity": "AMP + H(+) + H2O = IMP + NH4(+).", "evidence": [ { "id": "O08739", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08739" } ] }, { "ec_number": "3.5.4.6", "activity": "", "evidence": [ { "id": "O08739", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08739" } ] } ] }, { "uniprot_ac": "O08807", "gene_name": "Prdx4", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "O08807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08807" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "O08807", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08807" } ] } ] }, { "uniprot_ac": "O15488", "gene_name": "GYG2", "activity": [ { "ec_number": "2.4.1.186", "activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.", "evidence": [ { "id": "O15488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15488" } ] }, { "ec_number": "2.4.1.186", "activity": "", "evidence": [ { "id": "O15488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15488" } ] } ] }, { "uniprot_ac": "O35350", "gene_name": "Capn1", "activity": [ { "ec_number": "3.4.22.52", "activity": "Broad endopeptidase specificity.", "evidence": [ { "id": "O35350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35350" } ] }, { "ec_number": "3.4.22.52", "activity": "", "evidence": [ { "id": "O35350", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35350" } ] } ] }, { "uniprot_ac": "O35593", "gene_name": "Psmd14", "activity": [ { "ec_number": "3.4.19.-", "activity": "", "evidence": [ { "id": "O35593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35593" } ] } ] }, { "uniprot_ac": "O70370", "gene_name": "Ctss", "activity": [ { "ec_number": "3.4.22.27", "activity": "Similar to cathepsin L, but with much less activity on Z-Phe-Arg-|-NHMec, and more activity on the Z-Val-Val-Arg-|-Xaa compound.", "evidence": [ { "id": "O70370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70370" } ] }, { "ec_number": "3.4.22.27", "activity": "", "evidence": [ { "id": "O70370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70370" } ] } ] }, { "uniprot_ac": "O88844", "gene_name": "Idh1", "activity": [ { "ec_number": "1.1.1.42", "activity": "D-threo-isocitrate + NADP(+) = 2-oxoglutarate + CO2 + NADPH.", "evidence": [ { "id": "O88844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88844" } ] }, { "ec_number": "1.1.1.42", "activity": "", "evidence": [ { "id": "O88844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88844" } ] } ] }, { "uniprot_ac": "P03953", "gene_name": "Cfd", "activity": [ { "ec_number": "3.4.21.46", "activity": "Selective cleavage of Arg-|-Lys bond in complement factor B when in complex with complement subcomponent C3b or with cobra venom factor.", "evidence": [ { "id": "P03953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03953" } ] }, { "ec_number": "3.4.21.46", "activity": "", "evidence": [ { "id": "P03953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P03953" } ] } ] }, { "uniprot_ac": "P05063", "gene_name": "Aldoc", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P05063", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05063" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P05063", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05063" } ] } ] }, { "uniprot_ac": "P05064", "gene_name": "Aldoa", "activity": [ { "ec_number": "4.1.2.13", "activity": "beta-D-fructose 1,6-bisphosphate = D-glyceraldehyde 3-phosphate + dihydroxyacetone phosphate.", "evidence": [ { "id": "P05064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05064" } ] }, { "ec_number": "4.1.2.13", "activity": "", "evidence": [ { "id": "P05064", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05064" } ] } ] }, { "uniprot_ac": "P06745", "gene_name": "Gpi", "activity": [ { "ec_number": "5.3.1.9", "activity": "alpha-D-glucose 6-phosphate = beta-D-fructose 6-phosphate.", "evidence": [ { "id": "P06745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06745" } ] }, { "ec_number": "5.3.1.9", "activity": "", "evidence": [ { "id": "P06745", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06745" } ] } ] }, { "uniprot_ac": "P07901", "gene_name": "Hsp90aa1", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P07901", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07901" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P07901", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07901" } ] } ] }, { "uniprot_ac": "P08030", "gene_name": "Aprt", "activity": [ { "ec_number": "2.4.2.7", "activity": "AMP + diphosphate = 5-phospho-alpha-D-ribose 1-diphosphate + adenine.", "evidence": [ { "id": "P08030", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08030" } ] }, { "ec_number": "2.4.2.7", "activity": "", "evidence": [ { "id": "P08030", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08030" } ] } ] }, { "uniprot_ac": "P09528", "gene_name": "Fth1", "activity": [ { "ec_number": "1.16.3.1", "activity": "4 Fe(2+) + 4 H(+) + O2 = 4 Fe(3+) + 2 H2O.", "evidence": [ { "id": "P09528", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09528" } ] }, { "ec_number": "1.16.3.1", "activity": "", "evidence": [ { "id": "P09528", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09528" } ] } ] }, { "uniprot_ac": "P10126", "gene_name": "Eef1a1", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P10126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10126" } ] } ] }, { "uniprot_ac": "P10518", "gene_name": "Alad", "activity": [ { "ec_number": "4.2.1.24", "activity": "2 5-aminolevulinate = H(+) + 2 H2O + porphobilinogen.", "evidence": [ { "id": "P10518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10518" } ] }, { "ec_number": "4.2.1.24", "activity": "", "evidence": [ { "id": "P10518", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10518" } ] } ] }, { "uniprot_ac": "P10605", "gene_name": "Ctsb", "activity": [ { "ec_number": "3.4.22.1", "activity": "Hydrolysis of proteins with broad specificity for peptide bonds. Preferentially cleaves -Arg-Arg-|-Xaa bonds in small molecule substrates (thus differing from cathepsin L). In addition to being an endopeptidase, shows peptidyl-dipeptidase activity, liberating C-terminal dipeptides.", "evidence": [ { "id": "P10605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10605" } ] }, { "ec_number": "3.4.22.1", "activity": "", "evidence": [ { "id": "P10605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10605" } ] } ] }, { "uniprot_ac": "P12265", "gene_name": "Gusb", "activity": [ { "ec_number": "3.2.1.31", "activity": "a beta-D-glucuronoside + H2O = an alcohol + D-glucuronate.", "evidence": [ { "id": "P12265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12265" } ] }, { "ec_number": "3.2.1.31", "activity": "", "evidence": [ { "id": "P12265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12265" } ] } ] }, { "uniprot_ac": "P12382", "gene_name": "Pfkl", "activity": [ { "ec_number": "2.7.1.11", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H(+).", "evidence": [ { "id": "P12382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12382" } ] }, { "ec_number": "2.7.1.11", "activity": "", "evidence": [ { "id": "P12382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P12382" } ] } ] }, { "uniprot_ac": "P14234", "gene_name": "Fgr", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P14234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14234" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "P14234", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14234" } ] } ] }, { "uniprot_ac": "P17742", "gene_name": "Ppia", "activity": [ { "ec_number": "5.2.1.8", "activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).", "evidence": [ { "id": "P17742", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17742" } ] }, { "ec_number": "5.2.1.8", "activity": "", "evidence": [ { "id": "P17742", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17742" } ] } ] }, { "uniprot_ac": "P18242", "gene_name": "Ctsd", "activity": [ { "ec_number": "3.4.23.5", "activity": "Specificity similar to, but narrower than, that of pepsin A. Does not cleave the 4-Gln-|-His-5 bond in B chain of insulin.", "evidence": [ { "id": "P18242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18242" } ] }, { "ec_number": "3.4.23.5", "activity": "", "evidence": [ { "id": "P18242", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P18242" } ] } ] }, { "uniprot_ac": "P19157", "gene_name": "Gstp1", "activity": [ { "ec_number": "2.5.1.18", "activity": "glutathione + RX = a halide anion + an S-substituted glutathione + H(+).", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P19157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19157" } ] } ] }, { "uniprot_ac": "P23475", "gene_name": "Xrcc6", "activity": [ { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "P23475", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23475" } ] }, { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P23475", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23475" } ] } ] }, { "uniprot_ac": "P23492", "gene_name": "Pnp", "activity": [ { "ec_number": "2.4.2.1", "activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.", "evidence": [ { "id": "P23492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23492" } ] }, { "ec_number": "2.4.2.1", "activity": "", "evidence": [ { "id": "P23492", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23492" } ] } ] }, { "uniprot_ac": "P23780", "gene_name": "Glb1", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "P23780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23780" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "P23780", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23780" } ] } ] }, { "uniprot_ac": "P24270", "gene_name": "Cat", "activity": [ { "ec_number": "1.11.1.6", "activity": "2 H2O2 = 2 H2O + O2.", "evidence": [ { "id": "P24270", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24270" } ] }, { "ec_number": "1.11.1.6", "activity": "", "evidence": [ { "id": "P24270", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24270" } ] } ] }, { "uniprot_ac": "P24527", "gene_name": "Lta4h", "activity": [ { "ec_number": "3.3.2.6", "activity": "H2O + leukotriene A4 = leukotriene B4.", "evidence": [ { "id": "P24527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24527" } ] }, { "ec_number": "3.4.11.4", "activity": "Release of the N-terminal residue from a tripeptide.", "evidence": [ { "id": "P24527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24527" } ] }, { "ec_number": "3.3.2.6", "activity": "", "evidence": [ { "id": "P24527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24527" } ] } ] }, { "uniprot_ac": "P24547", "gene_name": "Impdh2", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "P24547", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24547" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "P24547", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P24547" } ] } ] }, { "uniprot_ac": "P27641", "gene_name": "Xrcc5", "activity": [ { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "P27641", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27641" } ] } ] }, { "uniprot_ac": "P34884", "gene_name": "Mif", "activity": [ { "ec_number": "5.3.2.1", "activity": "3-phenylpyruvate = enol-phenylpyruvate.", "evidence": [ { "id": "P34884", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34884" } ] }, { "ec_number": "5.3.3.12", "activity": "L-dopachrome = 5,6-dihydroxyindole-2-carboxylate.", "evidence": [ { "id": "P34884", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34884" } ] }, { "ec_number": "5.3.2.1", "activity": "", "evidence": [ { "id": "P34884", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P34884" } ] } ] }, { "uniprot_ac": "P36143", "gene_name": "GLG1", "activity": [ { "ec_number": "2.4.1.186", "activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.", "evidence": [ { "id": "P36143", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36143" } ] }, { "ec_number": "2.4.1.186", "activity": "", "evidence": [ { "id": "P36143", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36143" } ] } ] }, { "uniprot_ac": "P41245", "gene_name": "Mmp9", "activity": [ { "ec_number": "3.4.24.35", "activity": "Cleavage of gelatin types I and V and collagen types IV and V.", "evidence": [ { "id": "P41245", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41245" } ] }, { "ec_number": "3.4.24.35", "activity": "", "evidence": [ { "id": "P41245", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P41245" } ] } ] }, { "uniprot_ac": "P46976", "gene_name": "GYG1", "activity": [ { "ec_number": "2.4.1.186", "activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.", "evidence": [ { "id": "P46976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46976" } ] }, { "ec_number": "2.4.1.186", "activity": "", "evidence": [ { "id": "P46976", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46976" } ] } ] }, { "uniprot_ac": "P47011", "gene_name": "GLG2", "activity": [ { "ec_number": "2.4.1.186", "activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.", "evidence": [ { "id": "P47011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47011" } ] }, { "ec_number": "2.4.1.186", "activity": "", "evidence": [ { "id": "P47011", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47011" } ] } ] }, { "uniprot_ac": "P47811", "gene_name": "Mapk14", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P47811", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47811" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P47811", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47811" } ] } ] }, { "uniprot_ac": "P48999", "gene_name": "Alox5", "activity": [ { "ec_number": "1.13.11.-", "activity": "", "evidence": [ { "id": "P48999", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48999" } ] }, { "ec_number": "1.13.11.34", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + O2 = H2O + leukotriene A4.", "evidence": [ { "id": "P48999", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P48999" } ] } ] }, { "uniprot_ac": "P49290", "gene_name": "Epx", "activity": [ { "ec_number": "1.11.1.7", "activity": "2 a phenolic donor + H2O2 = 2 a phenolic radical donor + 2 H2O.", "evidence": [ { "id": "P49290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49290" } ] }, { "ec_number": "1.11.1.7", "activity": "", "evidence": [ { "id": "P49290", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P49290" } ] } ] }, { "uniprot_ac": "P50096", "gene_name": "Impdh1", "activity": [ { "ec_number": "1.1.1.205", "activity": "H2O + IMP + NAD(+) = H(+) + NADH + XMP.", "evidence": [ { "id": "P50096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50096" } ] }, { "ec_number": "1.1.1.205", "activity": "", "evidence": [ { "id": "P50096", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50096" } ] } ] }, { "uniprot_ac": "P50429", "gene_name": "Arsb", "activity": [ { "ec_number": "3.1.6.12", "activity": "Hydrolysis of the 4-sulfate groups of the N-acetyl-D-galactosamine 4-sulfate units of chondroitin sulfate and dermatan sulfate.", "evidence": [ { "id": "P50429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50429" } ] }, { "ec_number": "3.1.6.12", "activity": "", "evidence": [ { "id": "P50429", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50429" } ] } ] }, { "uniprot_ac": "P52480", "gene_name": "Pkm", "activity": [ { "ec_number": "2.7.1.40", "activity": "CTP + pyruvate = CDP + H(+) + phosphoenolpyruvate.", "evidence": [ { "id": "P52480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52480" } ] }, { "ec_number": "2.7.1.40", "activity": "", "evidence": [ { "id": "P52480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52480" } ] }, { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P52480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52480" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P52480", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52480" } ] } ] }, { "uniprot_ac": "P56389", "gene_name": "Cda", "activity": [ { "ec_number": "3.5.4.5", "activity": "2'-deoxycytidine + H(+) + H2O = 2'-deoxyuridine + NH4(+).", "evidence": [ { "id": "P56389", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56389" } ] }, { "ec_number": "3.5.4.5", "activity": "", "evidence": [ { "id": "P56389", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P56389" } ] } ] }, { "uniprot_ac": "P58252", "gene_name": "Eef2", "activity": [ { "ec_number": "3.6.5.-", "activity": "", "evidence": [ { "id": "P58252", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58252" } ] } ] }, { "uniprot_ac": "P63017", "gene_name": "Hspa8", "activity": [ { "ec_number": "3.6.4.10", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P63017", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63017" } ] }, { "ec_number": "3.6.4.10", "activity": "", "evidence": [ { "id": "P63017", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63017" } ] } ] }, { "uniprot_ac": "P63085", "gene_name": "Mapk1", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P63085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63085" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "P63085", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63085" } ] } ] }, { "uniprot_ac": "P70195", "gene_name": "Psmb7", "activity": [ { "ec_number": "3.4.25.1", "activity": "Cleavage of peptide bonds with very broad specificity.", "evidence": [ { "id": "P70195", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70195" } ] }, { "ec_number": "3.4.25.1", "activity": "", "evidence": [ { "id": "P70195", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70195" } ] } ] }, { "uniprot_ac": "P70335", "gene_name": "Rock1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "P70335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70335" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "P70335", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70335" } ] } ] }, { "uniprot_ac": "P70699", "gene_name": "Gaa", "activity": [ { "ec_number": "3.2.1.20", "activity": "Hydrolysis of terminal, non-reducing (1->4)-linked alpha-D-glucose residues with release of alpha-D-glucose.", "evidence": [ { "id": "P70699", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70699" } ] }, { "ec_number": "3.2.1.20", "activity": "", "evidence": [ { "id": "P70699", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70699" } ] } ] }, { "uniprot_ac": "Q01768", "gene_name": "Nme2", "activity": [ { "ec_number": "2.7.4.6", "activity": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP.", "evidence": [ { "id": "Q01768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01768" } ] }, { "ec_number": "2.7.13.3", "activity": "ATP + protein L-histidine = ADP + protein N-phospho-L-histidine.", "evidence": [ { "id": "Q01768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01768" } ] }, { "ec_number": "2.7.4.6", "activity": "", "evidence": [ { "id": "Q01768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01768" } ] } ] }, { "uniprot_ac": "Q01853", "gene_name": "Vcp", "activity": [ { "ec_number": "3.6.4.6", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q01853", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01853" } ] }, { "ec_number": "3.6.4.6", "activity": "", "evidence": [ { "id": "Q01853", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q01853" } ] } ] }, { "uniprot_ac": "Q3TRM8", "gene_name": "Hk3", "activity": [ { "ec_number": "2.7.1.1", "activity": "ATP + D-fructose = ADP + D-fructose 6-phosphate + H(+).", "evidence": [ { "id": "Q3TRM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TRM8" } ] }, { "ec_number": "2.7.1.1", "activity": "", "evidence": [ { "id": "Q3TRM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TRM8" } ] }, { "ec_number": "2.7.1.-", "activity": "", "evidence": [ { "id": "Q3TRM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TRM8" } ] } ] }, { "uniprot_ac": "Q61206", "gene_name": "Pafah1b2", "activity": [ { "ec_number": "3.1.1.47", "activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).", "evidence": [ { "id": "Q61206", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61206" } ] }, { "ec_number": "3.1.1.47", "activity": "", "evidence": [ { "id": "Q61206", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61206" } ] } ] }, { "uniprot_ac": "Q62167", "gene_name": "Ddx3x", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q62167", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62167" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "Q62167", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62167" } ] } ] }, { "uniprot_ac": "Q69ZA1", "gene_name": "Cdk13", "activity": [ { "ec_number": "2.7.11.22", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q69ZA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZA1" } ] }, { "ec_number": "2.7.11.23", "activity": "[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase].", "evidence": [ { "id": "Q69ZA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZA1" } ] }, { "ec_number": "2.7.11.23", "activity": "", "evidence": [ { "id": "Q69ZA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZA1" } ] }, { "ec_number": "2.7.11.22", "activity": "", "evidence": [ { "id": "Q69ZA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZA1" } ] } ] }, { "uniprot_ac": "Q7TMY8", "gene_name": "Huwe1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q7TMY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TMY8" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q7TMY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TMY8" } ] } ] }, { "uniprot_ac": "Q7TSV4", "gene_name": "Pgm2", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "Q7TSV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TSV4" } ] }, { "ec_number": "5.4.2.7", "activity": "2-deoxy-alpha-D-ribose 1-phosphate = 2-deoxy-D-ribose 5-phosphate.", "evidence": [ { "id": "Q7TSV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TSV4" } ] }, { "ec_number": "5.4.2.7", "activity": "", "evidence": [ { "id": "Q7TSV4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TSV4" } ] } ] }, { "uniprot_ac": "Q80UY2", "gene_name": "Kcmf1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q80UY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UY2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q80UY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80UY2" } ] } ] }, { "uniprot_ac": "Q8BFR4", "gene_name": "Gns", "activity": [ { "ec_number": "3.1.6.14", "activity": "Hydrolysis of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate.", "evidence": [ { "id": "Q8BFR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BFR4" } ] }, { "ec_number": "3.1.6.14", "activity": "", "evidence": [ { "id": "Q8BFR4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BFR4" } ] } ] }, { "uniprot_ac": "Q8K183", "gene_name": "Pdxk", "activity": [ { "ec_number": "2.7.1.35", "activity": "ATP + pyridoxal = ADP + H(+) + pyridoxal 5'-phosphate.", "evidence": [ { "id": "Q8K183", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K183" } ] }, { "ec_number": "2.7.1.35", "activity": "", "evidence": [ { "id": "Q8K183", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K183" } ] } ] }, { "uniprot_ac": "Q8R146", "gene_name": "Apeh", "activity": [ { "ec_number": "3.4.19.1", "activity": "Internal cleavage of oxidized and glycated proteins.", "evidence": [ { "id": "Q8R146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R146" } ] }, { "ec_number": "3.4.19.1", "activity": "", "evidence": [ { "id": "Q8R146", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R146" } ] } ] }, { "uniprot_ac": "Q8VCF1", "gene_name": "Cant1", "activity": [ { "ec_number": "3.6.1.6", "activity": "ADP + H2O = AMP + H(+) + phosphate.", "evidence": [ { "id": "Q8VCF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCF1" } ] }, { "ec_number": "3.6.1.6", "activity": "", "evidence": [ { "id": "Q8VCF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCF1" } ] } ] }, { "uniprot_ac": "Q91V92", "gene_name": "Acly", "activity": [ { "ec_number": "2.3.3.8", "activity": "acetyl-CoA + ADP + oxaloacetate + phosphate = ATP + citrate + CoA.", "evidence": [ { "id": "Q91V92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91V92" } ] }, { "ec_number": "2.3.3.8", "activity": "", "evidence": [ { "id": "Q91V92", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91V92" } ] } ] }, { "uniprot_ac": "Q91YP3", "gene_name": "Dera", "activity": [ { "ec_number": "4.1.2.4", "activity": "2-deoxy-D-ribose 5-phosphate = acetaldehyde + D-glyceraldehyde 3-phosphate.", "evidence": [ { "id": "Q91YP3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YP3" } ] }, { "ec_number": "4.1.2.4", "activity": "", "evidence": [ { "id": "Q91YP3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YP3" } ] } ] }, { "uniprot_ac": "Q9CYK2", "gene_name": "Qpct", "activity": [ { "ec_number": "2.3.2.5", "activity": "N-terminal L-glutaminyl-[peptide] = N-terminal 5-oxo-L-prolyl-[peptide] + NH4(+).", "evidence": [ { "id": "Q9CYK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CYK2" } ] }, { "ec_number": "2.3.2.5", "activity": "", "evidence": [ { "id": "Q9CYK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CYK2" } ] } ] }, { "uniprot_ac": "Q9D0F9", "gene_name": "Pgm1", "activity": [ { "ec_number": "5.4.2.2", "activity": "alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate.", "evidence": [ { "id": "Q9D0F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0F9" } ] }, { "ec_number": "5.4.2.2", "activity": "", "evidence": [ { "id": "Q9D0F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0F9" } ] } ] }, { "uniprot_ac": "Q9D6Y9", "gene_name": "Gbe1", "activity": [ { "ec_number": "2.4.1.18", "activity": "Transfers a segment of a (1->4)-alpha-D-glucan chain to a primary hydroxy group in a similar glucan chain.", "evidence": [ { "id": "Q9D6Y9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D6Y9" } ] }, { "ec_number": "2.4.1.18", "activity": "", "evidence": [ { "id": "Q9D6Y9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D6Y9" } ] } ] }, { "uniprot_ac": "Q9D8C9", "gene_name": "Pnp2", "activity": [ { "ec_number": "2.4.2.1", "activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.", "evidence": [ { "id": "Q9D8C9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D8C9" } ] }, { "ec_number": "2.4.2.1", "activity": "", "evidence": [ { "id": "Q9D8C9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D8C9" } ] } ] }, { "uniprot_ac": "Q9DBJ1", "gene_name": "Pgam1", "activity": [ { "ec_number": "5.4.2.11", "activity": "(2R)-2-phosphoglycerate = (2R)-3-phosphoglycerate.", "evidence": [ { "id": "Q9DBJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBJ1" } ] }, { "ec_number": "5.4.2.4", "activity": "(2R)-3-phospho-glyceroyl phosphate = (2R)-2,3-bisphosphoglycerate + H(+).", "evidence": [ { "id": "Q9DBJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBJ1" } ] }, { "ec_number": "5.4.2.4", "activity": "", "evidence": [ { "id": "Q9DBJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBJ1" } ] }, { "ec_number": "5.4.2.11", "activity": "", "evidence": [ { "id": "Q9DBJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBJ1" } ] } ] }, { "uniprot_ac": "Q9ET01", "gene_name": "Pygl", "activity": [ { "ec_number": "2.4.1.1", "activity": "[(1->4)-alpha-D-glucosyl](n) + phosphate = [(1->4)-alpha-D-glucosyl](n-1) + alpha-D-glucose 1-phosphate.", "evidence": [ { "id": "Q9ET01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ET01" } ] }, { "ec_number": "2.4.1.1", "activity": "", "evidence": [ { "id": "Q9ET01", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ET01" } ] } ] }, { "uniprot_ac": "Q9QZH3", "gene_name": "Ppie", "activity": [ { "ec_number": "5.2.1.8", "activity": "[protein]-peptidylproline (omega=180) = [protein]-peptidylproline (omega=0).", "evidence": [ { "id": "Q9QZH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZH3" } ] }, { "ec_number": "5.2.1.8", "activity": "", "evidence": [ { "id": "Q9QZH3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZH3" } ] } ] }, { "uniprot_ac": "Q9R062", "gene_name": "Gyg1", "activity": [ { "ec_number": "2.4.1.186", "activity": "[1,4-alpha-D-glucosyl](n)-L-tyrosyl-[glycogenin] + UDP-alpha-D-glucose = [1,4-alpha-D-glucosyl](n+1)-L-tyrosyl-[glycogenin] + H(+) + UDP.", "evidence": [ { "id": "Q9R062", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R062" } ] }, { "ec_number": "2.4.1.186", "activity": "", "evidence": [ { "id": "Q9R062", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R062" } ] } ] }, { "uniprot_ac": "Q9WUU7", "gene_name": "Ctsz", "activity": [ { "ec_number": "3.4.18.1", "activity": "Release of C-terminal amino acid residues with broad specificity, but lacks action on C-terminal proline. Shows weak endopeptidase activity.", "evidence": [ { "id": "Q9WUU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUU7" } ] }, { "ec_number": "3.4.18.1", "activity": "", "evidence": [ { "id": "Q9WUU7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUU7" } ] } ] }, { "uniprot_ac": "Q9WV54", "gene_name": "Asah1", "activity": [ { "ec_number": "3.5.1.23", "activity": "an N-acylsphing-4-enine + H2O = a fatty acid + sphing-4-enine.", "evidence": [ { "id": "Q9WV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV54" } ] }, { "ec_number": "3.5.1.-", "activity": "", "evidence": [ { "id": "Q9WV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV54" } ] }, { "ec_number": "3.5.1.23", "activity": "", "evidence": [ { "id": "Q9WV54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WV54" } ] } ] }, { "uniprot_ac": "Q9Z1E4", "gene_name": "Gys1", "activity": [ { "ec_number": "2.4.1.11", "activity": "[(1->4)-alpha-D-glucosyl](n) + UDP-alpha-D-glucose = [(1->4)-alpha-D-glucosyl](n+1) + H(+) + UDP.", "evidence": [ { "id": "Q9Z1E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1E4" } ] }, { "ec_number": "2.4.1.11", "activity": "", "evidence": [ { "id": "Q9Z1E4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1E4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }