{ "uniprot_canonical_ac": "Q9QZU9-1", "uniprot_ac": "Q9QZU9", "uniprot_id": "UB2L6_MOUSE", "mass": { "chemical_mass": 17841.0, "monoisotopic_mass": 17841.0 }, "refseq": { "ac": "NP_064333", "name": "ubiquitin/ISG15-conjugating enzyme E2 L6", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064333" }, "gene_names": [ { "name": "Ube2l6", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9QZU9", "id": "Q9QZU9" }, { "name": "2810489I21Rik; RIG-B; Ubce8; UBCH8; Ubcm8", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064333", "id": "NP_064333" }, { "name": "Ubce8", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9QZU9", "id": "Q9QZU9" }, { "name": "Ube2l6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064333", "id": "NP_064333" } ], "protein_names": [ { "name": "Ubiquitin/ISG15-conjugating enzyme E2 L6", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9QZU9" }, { "name": "2.3.2.23", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QZU9" }, { "name": "E2 ubiquitin-conjugating enzyme L6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QZU9" }, { "name": "UbcM8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QZU9" }, { "name": "Ubiquitin carrier protein L6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QZU9" }, { "name": "Ubiquitin-protein ligase L6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QZU9" }, { "name": "ubiquitin-conjugating enzyme 8; E2 ubiquitin-conjugating enzyme L6; E2 ubiquitin conjugating enzyme; ubiquitin-protein ligase L6; ubiquitin carrier protein L6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064333", "id": "NP_064333" }, { "name": "ubiquitin/ISG15-conjugating enzyme E2 L6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064333", "id": "NP_064333" } ], "function": [ { "annotation": "Catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Promotes ubiquitination and subsequent proteasomal degradation of FLT3.", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9#function" }, { "database": "UniProtKB", "id": "O14933", "url": "https://www.uniprot.org/uniprot/O14933#function" } ] }, { "annotation": "Ubc8 is a major ISG15-conjugating enzyme responsible for protein ISGylation upon interferon stimulation", "evidence": [ { "database": "RefSeq", "id": "NP_064333", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064333" }, { "database": "PubMed", "id": "15485925", "url": "https://glygen.org/publication/PubMed/15485925" } ] }, { "annotation": "We have identified a loss-of-function mutation in Ube2l6 that contributes to the chromosome 2 obesity quantitative trait locus.", "evidence": [ { "database": "RefSeq", "id": "NP_064333", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064333" }, { "database": "PubMed", "id": "23557705", "url": "https://glygen.org/publication/PubMed/23557705" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ube2l6", "url": "https://www.uniprot.org/uniprot/Q9QZU9", "locus": { "chromosome": "2", "start_pos": 84640679, "end_pos": 84629172, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000027078", "url": "https://www.ensembl.org/id/ENSMUSG00000027078" } ] } } ], "crossref": [ { "id": "ENSMUSG00000027078", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000027078", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00195", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00195", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "56791", "url": "https://www.ncbi.nlm.nih.gov/gene/56791", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000608", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000608", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016135", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016135", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023313", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023313", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:56791", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56791", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1914500", "url": "http://www.informatics.jax.org/marker/MGI:1914500", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "PPYNLRA", "url": "https://omabrowser.org/oma/group/PPYNLRA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5486024at2759", "url": "http://www.orthodb.org/?query=5486024at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24067", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24067", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24067:SF347", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24067:SF347", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00179", "url": "http://pfam.xfam.org/family/PF00179", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9QZU9", "url": "http://purl.obolibrary.org/obo/PR_Q9QZU9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5656169", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9833482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_064333", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064333", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A2ATR9", "url": "https://www.uniprot.org/uniprot/A2ATR9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2ATR9-1", "url": "https://www.uniprot.org/uniprot/A2ATR9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QZU9-1", "url": "https://www.uniprot.org/uniprot/Q9QZU9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMASKRVAKELESLSKELPPYLRQLSSDDANVLVWHMLLLPDQLPYGLKAFQVRIDFPREYPFKPPTLRFTTKIYHPNVREDGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEEPVRLELADLLTQNPEMFRKKAEEFTLKFGVDRPS", "length": 153, "header": "sp|Q9QZU9-1|UB2L6_MOUSE Isoform 1 of Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Mus musculus OX=10090 GN=Ube2l6 PE=1 SV=3 CANONICAL=Q9QZU9-1" }, "isoforms": [ { "isoform_ac": "A2ATR9-1", "url": "", "sequence": { "sequence": "MASKRVAKELESLSKELPPYLRQLSSDDANVLVWHMLLLPTLVWTFLSSLDRLTSQPQGSACLSSGMGITKDQLPYGLKAFQVRIDFPR", "length": 89, "header": "tr|A2ATR9-1|A2ATR9_MOUSE Computationally mapped isoform of Ubiquitin-conjugating enzyme E2L 6 OS=Mus musculus OX=10090 GN=Ube2l6 PE=4 SV=1 CANONICAL=Q9QZU9-1" }, "locus": { "chromosome": "2", "start_pos": 84636734, "end_pos": 84629253, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000150325.2", "url": "https://www.ensembl.org/id/ENSMUST00000150325.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000119507.2", "url": "https://www.ensembl.org/id/ENSMUSP00000119507.2" } ] } }, { "isoform_ac": "Q9QZU9-1", "url": "", "sequence": { "sequence": "MMASKRVAKELESLSKELPPYLRQLSSDDANVLVWHMLLLPDQLPYGLKAFQVRIDFPREYPFKPPTLRFTTKIYHPNVREDGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEEPVRLELADLLTQNPEMFRKKAEEFTLKFGVDRPS", "length": 153, "header": "sp|Q9QZU9-1|UB2L6_MOUSE Isoform 1 of Ubiquitin/ISG15-conjugating enzyme E2 L6 OS=Mus musculus OX=10090 GN=Ube2l6 PE=1 SV=3 CANONICAL=Q9QZU9-1" }, "locus": { "chromosome": "2", "start_pos": 84639497, "end_pos": 84629250, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000102642", "url": "https://www.ensembl.org/id/ENSMUST00000102642" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000099702", "url": "https://www.ensembl.org/id/ENSMUSP00000099702" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Interferon-inducible ubiquitin E2, Ubc8, is a conjugating enzyme for protein ISGylation.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Kim KI, Giannakopoulos NV, Virgin HW, Zhang DE", "evidence": [ { "database": "RefSeq", "id": "NP_064333", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064333" } ], "reference": [ { "type": "PubMed", "id": "15485925", "url": "https://glygen.org/publication/PubMed/15485925" } ] }, { "title": "Identification of a loss-of-function mutation in Ube2l6 associated with obesity resistance.", "journal": "Diabetes", "date": "2013", "authors": "Marcelin G, Liu SM, Schwartz GJ, Chua SC Jr", "evidence": [ { "database": "RefSeq", "id": "NP_064333", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064333" } ], "reference": [ { "type": "PubMed", "id": "23557705", "url": "https://glygen.org/publication/PubMed/23557705" } ] } ], "pathway": [ { "id": "mmu:56791", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56791", "resource": "KEGG Pathway" }, { "id": "R-MMU-1169408", "name": "ISG15 antiviral mechanism", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169408", "resource": "Reactome", "description": "ISG15 antiviral mechanism" }, { "id": "R-MMU-5656169", "name": "Termination of translesion DNA synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5656169", "resource": "Reactome", "description": "Termination of translesion DNA synthesis" }, { "id": "R-MMU-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" }, { "id": "R-MMU-9833482", "name": "PKR-mediated signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9833482", "resource": "Reactome", "description": "PKR-mediated signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "O14933-1", "protein_name": "Ubiquitin/ISG15-conjugating enzyme E2 L6", "gene_name": "UBE2L6", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPS", "length": 153 }, "evidence": [ { "id": "45244232", "url": "http://www.informatics.jax.org/homology/45244232", "database": "MGI" }, { "id": "Q9QZU9", "url": "https://omabrowser.org/oma/group/Q9QZU9/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q4V8J2-1", "protein_name": "Ubiquitin/ISG15-conjugating enzyme E2 L6", "gene_name": "Ube2l6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTASKRVAKELDDLSKELPPYLRHLSSDDANVLVWHMLLLPDQLPYRLKAFGLRIDFPREYPLKPPTLRFTTKIYHPNISEDGLVCLPLISTENWKPYTKAYQVLEALNILVSRPNLEEPVRLELADLLTQDPEMFRKKAEEFTLQYGVDRPS", "length": 153 }, "evidence": [ { "id": "45244232", "url": "http://www.informatics.jax.org/homology/45244232", "database": "MGI" }, { "id": "Q9QZU9", "url": "https://omabrowser.org/oma/group/Q9QZU9/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" }, { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" }, { "name": "ubiquitin-like protein transferase activity", "id": "GO:0019787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019787", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" }, { "name": "ubiquitin binding", "id": "GO:0043130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043130", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" }, { "name": "ISG15 transferase activity", "id": "GO:0042296", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042296", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" }, { "name": "ubiquitin conjugating enzyme activity", "id": "GO:0061631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061631", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" }, { "name": "ubiquitin ligase complex", "id": "GO:0000151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000151", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" }, { "name": "protein polyubiquitination", "id": "GO:0000209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000209", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" }, { "name": "ubiquitin-dependent protein catabolic process", "id": "GO:0006511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006511", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" }, { "name": "modification-dependent protein catabolic process", "id": "GO:0019941", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019941", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" }, { "name": "ISG15-protein conjugation", "id": "GO:0032020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032020", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "ISGylated.", "evidence": [ { "database": "UniProtKB", "id": "Q9QZU9", "url": "https://www.uniprot.org/uniprot/Q9QZU9" }, { "database": "PubMed", "id": "O14933", "url": "https://glygen.org/publication/PubMed/O14933" } ] } ], "interactions": [], "reactions": [ { "id": "R-MMU-1169394", "name": "ISGylation of IRF3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-MMU-166251" ], "output_participant_list": [], "enzyme_list": [ "Q9Z1K5-1", "Q9QZU9-1", "Q61510-1" ], "evidence": [ { "id": "R-MMU-1169394", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169394" } ] }, { "id": "R-MMU-1169398", "name": "ISGylation of host protein filamin B", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-MMU-354163" ], "output_participant_list": [], "enzyme_list": [ "Q9Z1K5-1", "Q9QZU9-1", "Q61510-1" ], "evidence": [ { "id": "R-MMU-1169398", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169398" } ] }, { "id": "R-MMU-1169402", "name": "ISGylation of E2 conjugating enzymes", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z1K5-1", "P61089-1", "P52482-1", "Q9QZU9-1", "Q61510-1" ], "evidence": [ { "id": "R-MMU-1169402", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169402" } ] }, { "id": "R-MMU-1169403", "name": "Interaction of E3 ligase with ISG15:E2 complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z1K5-1", "Q9QZU9-1", "Q61510-1" ], "evidence": [ { "id": "R-MMU-1169403", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169403" } ] }, { "id": "R-MMU-1169404", "name": "Transfer of ISG15 from E1 to E2 (UBCH8)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-MMU-936550" ], "enzyme_list": [ "Q9QZU9-1", "Q9DBK7-1" ], "evidence": [ { "id": "R-MMU-1169404", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169404" } ] }, { "id": "R-MMU-1169405", "name": "ISGylation of protein phosphatase 1 beta (PP2CB)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-MMU-1169375" ], "output_participant_list": [], "enzyme_list": [ "Q9Z1K5-1", "P36993-1", "Q9QZU9-1", "Q61510-1" ], "evidence": [ { "id": "R-MMU-1169405", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169405" } ] }, { "id": "R-MMU-1169406", "name": "ISGylation of host proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z1K5-1", "Q62077-1", "Q6Q899-1", "P52482-1", "Q9QZU9-1", "P52332-1", "Q63844-1", "Q03963-1", "Q61510-1" ], "evidence": [ { "id": "R-MMU-1169406", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1169406" } ] }, { "id": "R-MMU-1678842", "name": "Competitive inhibition of translation initiation by ISGylated 4EHP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P60843-1", "Q9Z1K5-1", "P10630-1", "Q9QZU9-1", "Q91VC3-1", "Q61510-1" ], "evidence": [ { "id": "R-MMU-1678842", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1678842" } ] }, { "id": "R-MMU-1678843", "name": "ISGylation of protein translation regulator 4EHP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9Z1K5-1", "Q9QZU9-1", "Q61510-1" ], "evidence": [ { "id": "R-MMU-1678843", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1678843" } ] }, { "id": "R-MMU-5653754", "name": "UBE2L6:TRIM25 ISGylates monoUb:K164-PCNA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q920Q2-1", "Q9JJN0-1", "Q9QUG2-1", "Q9QZU9-1", "Q6R3M4-1", "Q61510-1", "Q9DBK7-1" ], "evidence": [ { "id": "R-MMU-5653754", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5653754" } ] }, { "id": "R-MMU-5653756", "name": "TRIM25 binds monoUb:164-PCNA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q920Q2-1", "Q9JJN0-1", "Q9QUG2-1", "Q9QZU9-1", "Q6R3M4-1", "Q61510-1" ], "evidence": [ { "id": "R-MMU-5653756", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5653756" } ] }, { "id": "R-MMU-983140", "name": "Transfer of Ub from E2 to substrate and release of E2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CFI0-1", "Q6P073-1", "Q8CFI2-1", "Q91W82-1", "Q921J4-1", "Q922B6-1", "Q99PQ2-1", "Q9WUD1-1", "Q9WUB0-1", "Q8BM54-1", "Q8C432-1", "Q9DBU5-1", "Q9ET26-1", "Q9JI90-1", "Q7TMY8-1", "Q1PSW8-1", "Q8R516-1", "Q9D074-1", "O55176-3", "Q8BH75-1", "Q99KR6-1", "Q9D0C1-1", "Q9WTV7-1", "G5E870-1", "Q80WG7-1", "Q80X56-1", "Q8CH72-1", "Q3UE37-1", "Q8CCJ3-3", "Q8VDW4-1", "Q06986-1", "P60605-1", "Q3U487-1", "P97868-1", "Q5XPI3-1", "Q6PDX6-1", "Q91YL2-1", "A2A5Z6-1", "Q925F4-1", "Q99ML9-1", "Q9JIY2-1", "Q69ZI1-1", "O08759-1", "P62257-1", "Q6WKZ8-1", "Q6ZPJ3-1", "A2AN08-1", "Q71FD5-1", "Q8CHG5-1", "P61092-1", "Q3UIR3-1", "Q6I6G8-1", "Q05A36-1", "Q9QXP6-1", "A2A7Q9-1", "E9Q555-1", "P50636-1", "Q9QZR0-1", "Q9QZS2-1", "P61089-1", "Q38HM4-1", "Q9ESN2-1", "Q5FWH2-3", "Q8BX13-1", "O70481-1", "P52482-1", "P61080-1", "P61087-1", "P62254-1", "P62838-1", "P63147-1", "P68037-1", "Q6ZWZ2-1", "Q80U95-1", "Q8K2Z8-1", "Q9CY34-1", "Q9D1C1-1", "Q9ES34-1", "Q9JJZ4-1", "Q9QZU9-1", "Q9Z255-1", "Q91V17-1", "Q9CR50-1", "Q3TTA7-1", "Q80TR8-1", "O70263-1", "Q80U04-1", "Q80ZI6-1", "D3YYI7-1", "Q9CQE0-1", "Q8C863-1", "Q9WVS6-1", "Q62191-1", "Q7TPV2-1", "Q3U0D9-1", "Q4U2R1-1", "P46935-1", "F2Z461-1", "P62878-1", "Q8BKD6-1", "Q9CUN6-1", "Q8BZZ3-1", "Q69ZR2-1", "Q6PAV2-1", "Q8CDU6-1", "Q8C7M3-1", "Q8VIG6-1", "E9Q735-1", "P52483-1", "P61079-1", "P61082-1", "Q7TSS2-1", "Q9Z1K6-1", "Q8VEM1-1", "Q6A009-1", "Q5NCC3-1", "Q6PCX9-1", "Q810I2-1", "Q9DBK7-1" ], "evidence": [ { "id": "R-MMU-983140", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983140" } ] }, { "id": "R-MMU-983152", "name": "Transfer of ubiquitin from E1 to E2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6P073-1", "Q8CFI2-1", "Q91W82-1", "Q921J4-1", "Q3UE37-1", "Q8VDW4-1", "P60605-1", "P62257-1", "Q6ZPJ3-1", "Q8C7R4-1", "Q02053-1", "P61089-1", "P52482-1", "P61080-1", "P61087-1", "P62254-1", "P62838-1", "P63147-1", "P68037-1", "Q6ZWZ2-1", "Q8C878-1", "Q8K2Z8-1", "Q9CY34-1", "Q9D1C1-1", "Q9JJZ4-1", "Q9QZU9-1", "Q9Z255-1", "P52483-1", "P61079-1", "P61082-1", "Q7TSS2-1", "Q9DBK7-1" ], "evidence": [ { "id": "R-MMU-983152", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983152" } ] }, { "id": "R-MMU-983156", "name": "Polyubiquitination of substrate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CFI0-1", "Q6P073-1", "Q8CFI2-1", "Q91W82-1", "Q921J4-1", "Q922B6-1", "Q99PQ2-1", "Q9WUD1-1", "Q9WUB0-1", "Q8BM54-1", "Q8C432-1", "Q9DBU5-1", "Q9ET26-1", "Q9JI90-1", "Q7TMY8-1", "Q1PSW8-1", "Q8R516-1", "Q9D074-1", "O55176-3", "Q8BH75-1", "Q99KR6-1", "Q9D0C1-1", "Q9WTV7-1", "G5E870-1", "Q80WG7-1", "Q80X56-1", "Q8CH72-1", "Q3UE37-1", "Q8CCJ3-3", "Q8VDW4-1", "Q06986-1", "P60605-1", "Q3U487-1", "P97868-1", "Q5XPI3-1", "Q6PDX6-1", "Q91YL2-1", "A2A5Z6-1", "Q925F4-1", "Q99ML9-1", "Q9JIY2-1", "Q69ZI1-1", "O08759-1", "P62257-1", "Q6WKZ8-1", "Q6ZPJ3-1", "A2AN08-1", "Q71FD5-1", "Q8CHG5-1", "P61092-1", "Q3UIR3-1", "Q6I6G8-1", "Q05A36-1", "Q9QXP6-1", "A2A7Q9-1", "E9Q555-1", "P50636-1", "Q9QZR0-1", "Q9QZS2-1", "P61089-1", "Q38HM4-1", "Q9ESN2-1", "Q5FWH2-3", "Q8BX13-1", "O70481-1", "P52482-1", "P61080-1", "P61087-1", "P62254-1", "P62838-1", "P63147-1", "P68037-1", "Q6ZWZ2-1", "Q80U95-1", "Q8K2Z8-1", "Q9CY34-1", "Q9D1C1-1", "Q9ES34-1", "Q9JJZ4-1", "Q9QZU9-1", "Q9Z255-1", "Q91V17-1", "Q9CR50-1", "Q3TTA7-1", "Q80TR8-1", "O70263-1", "Q80U04-1", "Q80ZI6-1", "D3YYI7-1", "Q9CQE0-1", "Q8C863-1", "Q9WVS6-1", "Q62191-1", "Q7TPV2-1", "Q3U0D9-1", "Q4U2R1-1", "P46935-1", "F2Z461-1", "P62878-1", "Q8BKD6-1", "Q9CUN6-1", "Q8BZZ3-1", "Q69ZR2-1", "Q6PAV2-1", "Q8CDU6-1", "Q8C7M3-1", "Q8VIG6-1", "E9Q735-1", "P52483-1", "P61079-1", "P61082-1", "Q7TSS2-1", "Q9Z1K6-1", "Q8VEM1-1", "Q6A009-1", "Q5NCC3-1", "Q6PCX9-1", "Q810I2-1", "Q9DBK7-1" ], "evidence": [ { "id": "R-MMU-983156", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983156" } ] }, { "id": "R-MMU-983157", "name": "Interaction of E3 with substrate and E2-Ub complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q8CFI0-1", "Q6P073-1", "Q8CFI2-1", "Q91W82-1", "Q921J4-1", "Q922B6-1", "Q99PQ2-1", "Q9WUD1-1", "Q9WUB0-1", "Q8BM54-1", "Q8C432-1", "Q9DBU5-1", "Q9ET26-1", "Q9JI90-1", "Q7TMY8-1", "Q1PSW8-1", "Q8R516-1", "Q9D074-1", "O55176-3", "Q8BH75-1", "Q99KR6-1", "Q9D0C1-1", "Q9WTV7-1", "G5E870-1", "Q80WG7-1", "Q80X56-1", "Q8CH72-1", "Q3UE37-1", "Q8CCJ3-3", "Q8VDW4-1", "Q06986-1", "P60605-1", "Q3U487-1", "P97868-1", "Q5XPI3-1", "Q6PDX6-1", "Q91YL2-1", "A2A5Z6-1", "Q925F4-1", "Q99ML9-1", "Q9JIY2-1", "Q69ZI1-1", "O08759-1", "P62257-1", "Q6WKZ8-1", "Q6ZPJ3-1", "A2AN08-1", "Q71FD5-1", "Q8CHG5-1", "P61092-1", "Q3UIR3-1", "Q6I6G8-1", "Q05A36-1", "Q9QXP6-1", "A2A7Q9-1", "E9Q555-1", "P50636-1", "Q9QZR0-1", "Q9QZS2-1", "P61089-1", "Q38HM4-1", "Q9ESN2-1", "Q5FWH2-3", "Q8BX13-1", "O70481-1", "P52482-1", "P61080-1", "P61087-1", "P62254-1", "P62838-1", "P63147-1", "P68037-1", "Q6ZWZ2-1", "Q80U95-1", "Q8K2Z8-1", "Q9CY34-1", "Q9D1C1-1", "Q9ES34-1", "Q9JJZ4-1", "Q9QZU9-1", "Q9Z255-1", "Q91V17-1", "Q9CR50-1", "Q3TTA7-1", "Q80TR8-1", "O70263-1", "Q80U04-1", "Q80ZI6-1", "D3YYI7-1", "Q9CQE0-1", "Q8C863-1", "Q9WVS6-1", "Q62191-1", "Q7TPV2-1", "Q3U0D9-1", "Q4U2R1-1", "P46935-1", "F2Z461-1", "P62878-1", "Q8BKD6-1", "Q9CUN6-1", "Q8BZZ3-1", "Q69ZR2-1", "Q6PAV2-1", "Q8CDU6-1", "Q8C7M3-1", "Q8VIG6-1", "E9Q735-1", "P52483-1", "P61079-1", "P61082-1", "Q7TSS2-1", "Q9Z1K6-1", "Q8VEM1-1", "Q6A009-1", "Q5NCC3-1", "Q6PCX9-1", "Q810I2-1", "Q9DBK7-1" ], "evidence": [ { "id": "R-MMU-983157", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983157" } ] }, { "id": "R-MMU-9833973", "name": "ISGylation of PKR", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-MMU-168699" ], "output_participant_list": [ "R-MMU-936014" ], "enzyme_list": [ "Q9Z1K5-1", "Q9QZU9-1", "Q03963-1", "Q61510-1" ], "evidence": [ { "id": "R-MMU-9833973", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9833973" } ] } ], "reaction_participants": [ { "participant_id": "R-MMU-1169375", "participant_name": "PPM1B [cytosol]", "crossref": [ { "id": "ENSMUST00000112304", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000107924", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000234851", "database": "Ensembl", "url": "" }, { "id": "XP_006523925.1", "database": "RefSeq", "url": "" }, { "id": "P36993", "database": "PRO", "url": "" }, { "id": "101841", "database": "MGI", "url": "" }, { "id": "ENSMUST00000112305", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000157058", "database": "Ensembl", "url": "" }, { "id": "3.1.3.16", "database": "IntEnz", "url": "" }, { "id": "NP_001152970.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000107923", "database": "Ensembl", "url": "" }, { "id": "P36993", "database": "UniProt", "url": "" }, { "id": "ENSMUSG00000061130", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000157013", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000112307", "database": "Ensembl", "url": "" }, { "id": "NP_035281.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000107926", "database": "Ensembl", "url": "" }, { "id": "XP_006523924.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000157282", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000234540", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000234332", "database": "Ensembl", "url": "" }, { "id": "XP_011244625.1", "database": "RefSeq", "url": "" }, { "id": "NP_001152969.1", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-MMU-166251", "participant_name": "Irf3 [cytosol]", "crossref": [ { "id": "ENSMUST00000107834", "database": "Ensembl", "url": "" }, { "id": "NP_058545.1", "database": "RefSeq", "url": "" }, { "id": "7JFM", "database": "PDB", "url": "" }, { "id": "P70671", "database": "PRO", "url": "" }, { "id": "ENSMUSP00000146773", "database": "Ensembl", "url": "" }, { "id": "P70671", "database": "UniProt", "url": "" }, { "id": "ENSMUSP00000103465", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000003184", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000003284", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000003284", "database": "Ensembl", "url": "" }, { "id": "1859179", "database": "MGI", "url": "" }, { "id": "XP_006541058.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUST00000209066", "database": "Ensembl", "url": "" }, { "id": "XP_006541059.1", "database": "RefSeq", "url": "" } ] }, { "participant_id": "R-MMU-168699", "participant_name": "EIF2AK2 [cytosol]", "crossref": [ { "id": "NP_035293.1", "database": "RefSeq", "url": "" }, { "id": "Q03963", "database": "PRO", "url": "" }, { "id": "1353449", "database": "MGI", "url": "" }, { "id": "ENSMUST00000024884", "database": "Ensembl", "url": "" }, { "id": "Q03963", "database": "UniProt", "url": "" }, { "id": "ENSMUSG00000024079", "database": "Ensembl", "url": "" }, { "id": "1X48", "database": "PDB", "url": "" }, { "id": "1X49", "database": "PDB", "url": "" }, { "id": "ENSMUSP00000024884", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-MMU-354163", "participant_name": "Flnb [cytosol]", "crossref": [ { "id": "Q80X90", "database": "PRO", "url": "" }, { "id": "2446089", "database": "MGI", "url": "" }, { "id": "ENSMUSP00000052020", "database": "Ensembl", "url": "" }, { "id": "Q80X90", "database": "UniProt", "url": "" }, { "id": "NP_001074896.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUST00000052678", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000025278", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-MMU-936014", "participant_name": "Ube2l6 [cytosol]", "crossref": [ { "id": "Q9QZU9", "database": "UniProt", "url": "" }, { "id": "ENSMUST00000102642", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000027078", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000099702", "database": "Ensembl", "url": "" }, { "id": "Q9QZU9", "database": "PRO", "url": "" }, { "id": "NP_064333.2", "database": "RefSeq", "url": "" }, { "id": "1914500", "database": "MGI", "url": "" }, { "id": "2.3.2.23", "database": "IntEnz", "url": "" } ] }, { "participant_id": "R-MMU-936550", "participant_name": "Uba7 [cytosol]", "crossref": [ { "id": "Q9DBK7", "database": "UniProt", "url": "" }, { "id": "ENSMUSG00000032596", "database": "Ensembl", "url": "" }, { "id": "NP_076227.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000035216", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000035216", "database": "Ensembl", "url": "" }, { "id": "1349462", "database": "MGI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A2A5Z6", "gene_name": "Smurf2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A2A5Z6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A5Z6" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "A2A5Z6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A5Z6" } ] } ] }, { "uniprot_ac": "A2A7Q9", "gene_name": "Rnf19b", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "A2A7Q9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A7Q9" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "A2A7Q9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A7Q9" } ] } ] }, { "uniprot_ac": "A2AN08", "gene_name": "Ubr4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "A2AN08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AN08" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "A2AN08", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AN08" } ] } ] }, { "uniprot_ac": "D3YYI7", "gene_name": "Rnf217", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "D3YYI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3YYI7" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "D3YYI7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3YYI7" } ] } ] }, { "uniprot_ac": "E9Q555", "gene_name": "Rnf213", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "E9Q555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q555" } ] }, { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "E9Q555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q555" } ] }, { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "E9Q555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q555" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "E9Q555", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q555" } ] } ] }, { "uniprot_ac": "E9Q735", "gene_name": "Ube4a", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "E9Q735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q735" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "E9Q735", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9Q735" } ] } ] }, { "uniprot_ac": "F2Z461", "gene_name": "Herc6", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "F2Z461", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F2Z461" } ] } ] }, { "uniprot_ac": "G5E870", "gene_name": "Trip12", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "G5E870", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G5E870" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "G5E870", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/G5E870" } ] } ] }, { "uniprot_ac": "O08759", "gene_name": "Ube3a", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O08759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08759" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "O08759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08759" } ] } ] }, { "uniprot_ac": "O55176", "gene_name": "Pja1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O55176", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55176" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O55176", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O55176" } ] } ] }, { "uniprot_ac": "O70263", "gene_name": "Lnx1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O70263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70263" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O70263", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70263" } ] } ] }, { "uniprot_ac": "O70481", "gene_name": "Ubr1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "O70481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70481" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "O70481", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70481" } ] } ] }, { "uniprot_ac": "P10630", "gene_name": "Eif4a2", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P10630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10630" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "P10630", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10630" } ] } ] }, { "uniprot_ac": "P36993", "gene_name": "Ppm1b", "activity": [ { "ec_number": "3.1.3.16", "activity": "H2O + O-phospho-L-threonyl-[protein] = L-threonyl-[protein] + phosphate.", "evidence": [ { "id": "P36993", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36993" } ] }, { "ec_number": "3.1.3.16", "activity": "", "evidence": [ { "id": "P36993", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36993" } ] } ] }, { "uniprot_ac": "P46935", "gene_name": "Nedd4", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P46935", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46935" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "P46935", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46935" } ] } ] }, { "uniprot_ac": "P50636", "gene_name": "Rnf19a", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "P50636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50636" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "P50636", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50636" } ] } ] }, { "uniprot_ac": "P52332", "gene_name": "Jak1", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "P52332", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52332" } ] }, { "ec_number": "2.7.10.2", "activity": "", "evidence": [ { "id": "P52332", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52332" } ] } ] }, { "uniprot_ac": "P52482", "gene_name": "Ube2e1", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P52482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52482" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P52482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52482" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P52482", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52482" } ] } ] }, { "uniprot_ac": "P52483", "gene_name": "Ube2e3", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P52483", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52483" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P52483", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52483" } ] } ] }, { "uniprot_ac": "P60605", "gene_name": "Ube2g2", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P60605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60605" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P60605", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60605" } ] } ] }, { "uniprot_ac": "P60843", "gene_name": "Eif4a1", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "P60843", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60843" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "P60843", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P60843" } ] } ] }, { "uniprot_ac": "P61079", "gene_name": "Ube2d3", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P61079", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61079" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P61079", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61079" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P61079", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61079" } ] } ] }, { "uniprot_ac": "P61080", "gene_name": "Ube2d1", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P61080", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61080" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P61080", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61080" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P61080", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61080" } ] } ] }, { "uniprot_ac": "P61082", "gene_name": "Ube2m", "activity": [ { "ec_number": "2.3.2.34", "activity": "[E1 NEDD8-activating enzyme]-S-[NEDD8 protein]-yl-L-cysteine + [E2 NEDD8-conjugating enzyme]-L-cysteine = [E1 NEDD8-activating enzyme]-L-cysteine + [E2 NEDD8-conjugating enzyme]-S-[NEDD8-protein]-yl-L-cysteine.", "evidence": [ { "id": "P61082", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61082" } ] }, { "ec_number": "2.3.2.34", "activity": "", "evidence": [ { "id": "P61082", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61082" } ] } ] }, { "uniprot_ac": "P61087", "gene_name": "Ube2k", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P61087", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61087" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P61087", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61087" } ] } ] }, { "uniprot_ac": "P61089", "gene_name": "Ube2n", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P61089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61089" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P61089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61089" } ] } ] }, { "uniprot_ac": "P61092", "gene_name": "Siah1a", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P61092", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61092" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P61092", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61092" } ] } ] }, { "uniprot_ac": "P62254", "gene_name": "Ube2g1", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P62254", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62254" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P62254", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62254" } ] } ] }, { "uniprot_ac": "P62257", "gene_name": "Ube2h", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P62257", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62257" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P62257", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62257" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P62257", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62257" } ] } ] }, { "uniprot_ac": "P62838", "gene_name": "Ube2d2", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P62838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62838" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P62838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62838" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P62838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62838" } ] } ] }, { "uniprot_ac": "P62878", "gene_name": "Rbx1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] }, { "ec_number": "2.3.2.32", "activity": "S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N(6)-[NEDD8-protein]-yl-[cullin]-L-lysine.", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] }, { "ec_number": "2.3.2.32", "activity": "", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] } ] }, { "uniprot_ac": "P63147", "gene_name": "Ube2b", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P63147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63147" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P63147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63147" } ] } ] }, { "uniprot_ac": "P68037", "gene_name": "Ube2l3", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P68037", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68037" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P68037", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P68037" } ] } ] }, { "uniprot_ac": "P97868", "gene_name": "Rbbp6", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P97868", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97868" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P97868", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97868" } ] } ] }, { "uniprot_ac": "Q02053", "gene_name": "Uba1", "activity": [ { "ec_number": "6.2.1.45", "activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.", "evidence": [ { "id": "Q02053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02053" } ] }, { "ec_number": "6.2.1.45", "activity": "", "evidence": [ { "id": "Q02053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q02053" } ] } ] }, { "uniprot_ac": "Q03963", "gene_name": "Eif2ak2", "activity": [ { "ec_number": "2.7.10.2", "activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].", "evidence": [ { "id": "Q03963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03963" } ] }, { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q03963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03963" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "Q03963", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03963" } ] } ] }, { "uniprot_ac": "Q05A36", "gene_name": "Mex3c", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q05A36", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05A36" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q05A36", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05A36" } ] } ] }, { "uniprot_ac": "Q06986", "gene_name": "Siah2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q06986", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06986" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q06986", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06986" } ] } ] }, { "uniprot_ac": "Q1PSW8", "gene_name": "Trim71", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q1PSW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1PSW8" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q1PSW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1PSW8" } ] } ] }, { "uniprot_ac": "Q38HM4", "gene_name": "Trim63", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q38HM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q38HM4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q38HM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q38HM4" } ] } ] }, { "uniprot_ac": "Q3TTA7", "gene_name": "Cblb", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q3TTA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TTA7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q3TTA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TTA7" } ] } ] }, { "uniprot_ac": "Q3U0D9", "gene_name": "Hace1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q3U0D9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U0D9" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q3U0D9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U0D9" } ] } ] }, { "uniprot_ac": "Q3U487", "gene_name": "Hectd3", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q3U487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U487" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q3U487", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3U487" } ] } ] }, { "uniprot_ac": "Q3UE37", "gene_name": "Ube2z", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q3UE37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UE37" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q3UE37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UE37" } ] } ] }, { "uniprot_ac": "Q3UIR3", "gene_name": "Dtx3l", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q3UIR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UIR3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q3UIR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UIR3" } ] } ] }, { "uniprot_ac": "Q4U2R1", "gene_name": "Herc2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q4U2R1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4U2R1" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q4U2R1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4U2R1" } ] } ] }, { "uniprot_ac": "Q5FWH2", "gene_name": "Unkl", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "Q5FWH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5FWH2" } ] } ] }, { "uniprot_ac": "Q5NCC3", "gene_name": "Trim41", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5NCC3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5NCC3" } ] } ] }, { "uniprot_ac": "Q5XPI3", "gene_name": "Rnf123", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5XPI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XPI3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5XPI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XPI3" } ] } ] }, { "uniprot_ac": "Q61510", "gene_name": "Trim25", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q61510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61510" } ] }, { "ec_number": "6.3.2.n3", "activity": "ATP + [ISG15] + [protein]-lysine = AMP + diphosphate + [protein]-N-ISGyllysine.", "evidence": [ { "id": "Q61510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61510" } ] }, { "ec_number": "6.3.2.n3", "activity": "", "evidence": [ { "id": "Q61510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61510" } ] } ] }, { "uniprot_ac": "Q62077", "gene_name": "Plcg1", "activity": [ { "ec_number": "3.1.4.11", "activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+).", "evidence": [ { "id": "Q62077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62077" } ] }, { "ec_number": "3.1.4.11", "activity": "", "evidence": [ { "id": "Q62077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62077" } ] } ] }, { "uniprot_ac": "Q62191", "gene_name": "Trim21", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q62191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62191" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q62191", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62191" } ] } ] }, { "uniprot_ac": "Q63844", "gene_name": "Mapk3", "activity": [ { "ec_number": "2.7.11.24", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q63844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63844" } ] }, { "ec_number": "2.7.11.24", "activity": "", "evidence": [ { "id": "Q63844", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63844" } ] } ] }, { "uniprot_ac": "Q69ZI1", "gene_name": "Sh3rf1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q69ZI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZI1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q69ZI1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZI1" } ] } ] }, { "uniprot_ac": "Q69ZR2", "gene_name": "Hectd1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q69ZR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZR2" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q69ZR2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q69ZR2" } ] } ] }, { "uniprot_ac": "Q6A009", "gene_name": "Ltn1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6A009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6A009" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6A009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6A009" } ] } ] }, { "uniprot_ac": "Q6I6G8", "gene_name": "Hecw2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6I6G8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6I6G8" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q6I6G8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6I6G8" } ] } ] }, { "uniprot_ac": "Q6P073", "gene_name": "Ube2j2", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q6P073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P073" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q6P073", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P073" } ] } ] }, { "uniprot_ac": "Q6PAV2", "gene_name": "Herc4", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6PAV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PAV2" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q6PAV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PAV2" } ] } ] }, { "uniprot_ac": "Q6PCX9", "gene_name": "Trim37", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6PCX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PCX9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6PCX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PCX9" } ] } ] }, { "uniprot_ac": "Q6PDX6", "gene_name": "Rnf220", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6PDX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDX6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6PDX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDX6" } ] } ] }, { "uniprot_ac": "Q6Q899", "gene_name": "Rigi", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q6Q899", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6Q899" } ] } ] }, { "uniprot_ac": "Q6R3M4", "gene_name": "Poli", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q6R3M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6R3M4" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q6R3M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6R3M4" } ] } ] }, { "uniprot_ac": "Q6WKZ8", "gene_name": "Ubr2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6WKZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6WKZ8" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6WKZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6WKZ8" } ] } ] }, { "uniprot_ac": "Q6ZPJ3", "gene_name": "Ube2o", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6ZPJ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZPJ3" } ] }, { "ec_number": "2.3.2.24", "activity": "", "evidence": [ { "id": "Q6ZPJ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZPJ3" } ] } ] }, { "uniprot_ac": "Q6ZWZ2", "gene_name": "Ube2r2", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q6ZWZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZWZ2" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q6ZWZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZWZ2" } ] } ] }, { "uniprot_ac": "Q71FD5", "gene_name": "Znrf2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q71FD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q71FD5" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q71FD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q71FD5" } ] } ] }, { "uniprot_ac": "Q7TMY8", "gene_name": "Huwe1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q7TMY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TMY8" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q7TMY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TMY8" } ] } ] }, { "uniprot_ac": "Q7TPV2", "gene_name": "Dzip3", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q7TPV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TPV2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q7TPV2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TPV2" } ] } ] }, { "uniprot_ac": "Q7TSS2", "gene_name": "Ube2q1", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q7TSS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TSS2" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q7TSS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TSS2" } ] } ] }, { "uniprot_ac": "Q80TR8", "gene_name": "Dcaf1", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "Q80TR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80TR8" } ] } ] }, { "uniprot_ac": "Q80U04", "gene_name": "Pja2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q80U04", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80U04" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q80U04", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80U04" } ] } ] }, { "uniprot_ac": "Q80U95", "gene_name": "Ube3c", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q80U95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80U95" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q80U95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80U95" } ] } ] }, { "uniprot_ac": "Q80WG7", "gene_name": "Trim36", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q80WG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80WG7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q80WG7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80WG7" } ] } ] }, { "uniprot_ac": "Q80X56", "gene_name": "Trim69", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q80X56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X56" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q80X56", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X56" } ] } ] }, { "uniprot_ac": "Q80ZI6", "gene_name": "Lrsam1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q80ZI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZI6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q80ZI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZI6" } ] } ] }, { "uniprot_ac": "Q810I2", "gene_name": "Trim50", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q810I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810I2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q810I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810I2" } ] } ] }, { "uniprot_ac": "Q8BH75", "gene_name": "Rnf41", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8BH75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BH75" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8BH75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BH75" } ] } ] }, { "uniprot_ac": "Q8BKD6", "gene_name": "Rnf144b", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q8BKD6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BKD6" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q8BKD6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BKD6" } ] } ] }, { "uniprot_ac": "Q8BM54", "gene_name": "Mylip", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8BM54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BM54" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8BM54", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BM54" } ] } ] }, { "uniprot_ac": "Q8BX13", "gene_name": "Ube3d", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8BX13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BX13" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q8BX13", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BX13" } ] } ] }, { "uniprot_ac": "Q8BZZ3", "gene_name": "Wwp1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8BZZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZZ3" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q8BZZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZZ3" } ] } ] }, { "uniprot_ac": "Q8C432", "gene_name": "Rnf182", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8C432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C432" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8C432", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C432" } ] } ] }, { "uniprot_ac": "Q8C7M3", "gene_name": "Trim9", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8C7M3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C7M3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8C7M3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C7M3" } ] } ] }, { "uniprot_ac": "Q8C7R4", "gene_name": "Uba6", "activity": [ { "ec_number": "6.2.1.45", "activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.", "evidence": [ { "id": "Q8C7R4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C7R4" } ] }, { "ec_number": "6.2.1.45", "activity": "", "evidence": [ { "id": "Q8C7R4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C7R4" } ] } ] }, { "uniprot_ac": "Q8C863", "gene_name": "Itch", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8C863", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C863" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q8C863", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C863" } ] } ] }, { "uniprot_ac": "Q8C878", "gene_name": "Uba3", "activity": [ { "ec_number": "6.2.1.64", "activity": "ATP + [NEDD8 protein] + [E1 NEDD8-activating enzyme]-L-cysteine = AMP + diphosphate + [E1 NEDD8-activating enzyme]-S-[NEDD8 protein]-yl-L-cysteine.", "evidence": [ { "id": "Q8C878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C878" } ] }, { "ec_number": "6.2.1.64", "activity": "", "evidence": [ { "id": "Q8C878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C878" } ] } ] }, { "uniprot_ac": "Q8CCJ3", "gene_name": "Ufl1", "activity": [ { "ec_number": "2.3.2.-", "activity": "", "evidence": [ { "id": "Q8CCJ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CCJ3" } ] } ] }, { "uniprot_ac": "Q8CDU6", "gene_name": "Hectd2", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8CDU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CDU6" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q8CDU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CDU6" } ] } ] }, { "uniprot_ac": "Q8CFI0", "gene_name": "Nedd4l", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8CFI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFI0" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q8CFI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFI0" } ] }, { "ec_number": "2.3.2.36", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-cysteine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-S-ubiquitinyl-L-cysteine.", "evidence": [ { "id": "Q8CFI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFI0" } ] }, { "ec_number": "2.3.2.36", "activity": "", "evidence": [ { "id": "Q8CFI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFI0" } ] } ] }, { "uniprot_ac": "Q8CFI2", "gene_name": "Cdc34", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8CFI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFI2" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q8CFI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFI2" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q8CFI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CFI2" } ] } ] }, { "uniprot_ac": "Q8CH72", "gene_name": "Trim32", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8CH72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CH72" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8CH72", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CH72" } ] } ] }, { "uniprot_ac": "Q8CHG5", "gene_name": "Arel1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8CHG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHG5" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q8CHG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CHG5" } ] } ] }, { "uniprot_ac": "Q8K2Z8", "gene_name": "Ube2q2", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q8K2Z8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Z8" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q8K2Z8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K2Z8" } ] } ] }, { "uniprot_ac": "Q8R516", "gene_name": "Mib2", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8R516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R516" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8R516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R516" } ] } ] }, { "uniprot_ac": "Q8VDW4", "gene_name": "Ube2w", "activity": [ { "ec_number": "2.3.2.25", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-N-terminal-amino acid = [E1 ubiquitin-activating enzyme]-L-cysteine + N-terminal-ubiquitinyl-[acceptor protein].", "evidence": [ { "id": "Q8VDW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDW4" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q8VDW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDW4" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q8VDW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VDW4" } ] } ] }, { "uniprot_ac": "Q8VEM1", "gene_name": "Rnf130", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8VEM1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEM1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8VEM1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEM1" } ] } ] }, { "uniprot_ac": "Q8VIG6", "gene_name": "Traip", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q8VIG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VIG6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q8VIG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VIG6" } ] } ] }, { "uniprot_ac": "Q91V17", "gene_name": "Znrf1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q91V17", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91V17" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q91V17", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91V17" } ] } ] }, { "uniprot_ac": "Q91VC3", "gene_name": "Eif4a3", "activity": [ { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q91VC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VC3" } ] }, { "ec_number": "3.6.4.13", "activity": "", "evidence": [ { "id": "Q91VC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91VC3" } ] } ] }, { "uniprot_ac": "Q91W82", "gene_name": "Ube2e2", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q91W82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91W82" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q91W82", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91W82" } ] } ] }, { "uniprot_ac": "Q91YL2", "gene_name": "Rnf126", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q91YL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YL2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q91YL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YL2" } ] } ] }, { "uniprot_ac": "Q920Q2", "gene_name": "Rev1", "activity": [ { "ec_number": "2.7.7.-", "activity": "", "evidence": [ { "id": "Q920Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q920Q2" } ] } ] }, { "uniprot_ac": "Q921J4", "gene_name": "Ube2s", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q921J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q921J4" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q921J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q921J4" } ] } ] }, { "uniprot_ac": "Q922B6", "gene_name": "Traf7", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q922B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922B6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q922B6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922B6" } ] } ] }, { "uniprot_ac": "Q925F4", "gene_name": "Ubox5", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q925F4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q925F4" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q925F4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q925F4" } ] } ] }, { "uniprot_ac": "Q99KR6", "gene_name": "Rnf34", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q99KR6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KR6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q99KR6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99KR6" } ] } ] }, { "uniprot_ac": "Q99ML9", "gene_name": "Rnf111", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q99ML9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99ML9" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q99ML9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99ML9" } ] } ] }, { "uniprot_ac": "Q99PQ2", "gene_name": "Trim11", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q99PQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PQ2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q99PQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PQ2" } ] } ] }, { "uniprot_ac": "Q9CQE0", "gene_name": "Rnf138", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9CQE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQE0" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9CQE0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQE0" } ] } ] }, { "uniprot_ac": "Q9CR50", "gene_name": "Rchy1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9CR50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CR50" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9CR50", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CR50" } ] } ] }, { "uniprot_ac": "Q9CUN6", "gene_name": "Smurf1", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9CUN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CUN6" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q9CUN6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CUN6" } ] } ] }, { "uniprot_ac": "Q9CY34", "gene_name": "Ube2f", "activity": [ { "ec_number": "2.3.2.34", "activity": "[E1 NEDD8-activating enzyme]-S-[NEDD8 protein]-yl-L-cysteine + [E2 NEDD8-conjugating enzyme]-L-cysteine = [E1 NEDD8-activating enzyme]-L-cysteine + [E2 NEDD8-conjugating enzyme]-S-[NEDD8-protein]-yl-L-cysteine.", "evidence": [ { "id": "Q9CY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CY34" } ] }, { "ec_number": "2.3.2.34", "activity": "", "evidence": [ { "id": "Q9CY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CY34" } ] } ] }, { "uniprot_ac": "Q9D074", "gene_name": "Mgrn1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9D074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D074" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9D074", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D074" } ] } ] }, { "uniprot_ac": "Q9D0C1", "gene_name": "Rnf115", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9D0C1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0C1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9D0C1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D0C1" } ] } ] }, { "uniprot_ac": "Q9D1C1", "gene_name": "Ube2c", "activity": [ { "ec_number": "2.3.2.24", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N(6)-monoubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9D1C1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1C1" } ] }, { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q9D1C1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1C1" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q9D1C1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1C1" } ] } ] }, { "uniprot_ac": "Q9DBK7", "gene_name": "Uba7", "activity": [ { "ec_number": "6.2.1.45", "activity": "ATP + ubiquitin + [E1 ubiquitin-activating enzyme]-L-cysteine = AMP + diphosphate + S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine.", "evidence": [ { "id": "Q9DBK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBK7" } ] }, { "ec_number": "6.2.1.45", "activity": "", "evidence": [ { "id": "Q9DBK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBK7" } ] } ] }, { "uniprot_ac": "Q9DBU5", "gene_name": "Rnf6", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9DBU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBU5" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9DBU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBU5" } ] } ] }, { "uniprot_ac": "Q9ES34", "gene_name": "Ube3b", "activity": [ { "ec_number": "2.3.2.26", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9ES34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ES34" } ] }, { "ec_number": "2.3.2.26", "activity": "", "evidence": [ { "id": "Q9ES34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ES34" } ] } ] }, { "uniprot_ac": "Q9ESN2", "gene_name": "Trim39", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9ESN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESN2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9ESN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ESN2" } ] } ] }, { "uniprot_ac": "Q9ET26", "gene_name": "Rnf114", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9ET26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ET26" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9ET26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ET26" } ] } ] }, { "uniprot_ac": "Q9JI90", "gene_name": "Rnf14", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q9JI90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JI90" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q9JI90", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JI90" } ] } ] }, { "uniprot_ac": "Q9JIY2", "gene_name": "Cbll1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9JIY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIY2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9JIY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIY2" } ] } ] }, { "uniprot_ac": "Q9JJN0", "gene_name": "Polh", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9JJN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJN0" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9JJN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJN0" } ] } ] }, { "uniprot_ac": "Q9JJZ4", "gene_name": "Ube2j1", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q9JJZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJZ4" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q9JJZ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJZ4" } ] } ] }, { "uniprot_ac": "Q9QUG2", "gene_name": "Polk", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9QUG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUG2" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9QUG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUG2" } ] } ] }, { "uniprot_ac": "Q9QXP6", "gene_name": "Mkrn1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9QXP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXP6" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9QXP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXP6" } ] } ] }, { "uniprot_ac": "Q9QZR0", "gene_name": "Rnf25", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9QZR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZR0" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9QZR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZR0" } ] } ] }, { "uniprot_ac": "Q9QZS2", "gene_name": "Rnf4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9QZS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZS2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9QZS2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZS2" } ] } ] }, { "uniprot_ac": "Q9QZU9", "gene_name": "Ube2l6", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q9QZU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q9QZU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QZU9" } ] } ] }, { "uniprot_ac": "Q9WTV7", "gene_name": "Rlim", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9WTV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTV7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9WTV7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTV7" } ] } ] }, { "uniprot_ac": "Q9WUB0", "gene_name": "Rbck1", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q9WUB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUB0" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q9WUB0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUB0" } ] } ] }, { "uniprot_ac": "Q9WUD1", "gene_name": "Stub1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9WUD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUD1" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9WUD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WUD1" } ] } ] }, { "uniprot_ac": "Q9WVS6", "gene_name": "Prkn", "activity": [ { "ec_number": "6.3.2.19", "activity": "", "evidence": [ { "id": "Q9WVS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVS6" } ] }, { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q9WVS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVS6" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q9WVS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVS6" } ] } ] }, { "uniprot_ac": "Q9Z1K5", "gene_name": "Arih1", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q9Z1K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1K5" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q9Z1K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1K5" } ] } ] }, { "uniprot_ac": "Q9Z1K6", "gene_name": "Arih2", "activity": [ { "ec_number": "2.3.2.31", "activity": "[E2 ubiquitin-conjugating enzyme]-S-ubiquitinyl-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-N(6)-ubiquitinyl-L-lysine.", "evidence": [ { "id": "Q9Z1K6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1K6" } ] }, { "ec_number": "2.3.2.31", "activity": "", "evidence": [ { "id": "Q9Z1K6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z1K6" } ] } ] }, { "uniprot_ac": "Q9Z255", "gene_name": "Ube2a", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "Q9Z255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z255" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "Q9Z255", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z255" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }