{
    "uniprot_canonical_ac": "Q9QYY7-1",
    "uniprot_ac": "Q9QYY7",
    "uniprot_id": "ESM1_MOUSE",
    "mass": {
        "chemical_mass": 20043.0,
        "monoisotopic_mass": 20043.0
    },
    "refseq": {
        "ac": "NP_076101",
        "name": "endothelial cell-specific molecule 1 precursor",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
    },
    "gene_names": [
        {
            "name": "Esm1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9QYY7",
            "id": "Q9QYY7"
        },
        {
            "name": "0610042H23Rik; ESM-1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101",
            "id": "NP_076101"
        },
        {
            "name": "Esm1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101",
            "id": "NP_076101"
        }
    ],
    "protein_names": [
        {
            "name": "Endothelial cell-specific molecule 1",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9QYY7"
        },
        {
            "name": "ESM-1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9QYY7"
        },
        {
            "name": "endothelial cell-specific molecule 1 precursor",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101",
            "id": "NP_076101"
        }
    ],
    "function": [
        {
            "annotation": "A paracrine vasoregulatory pathway mediated by endothelial cell-derived ET-1 acting on the vascular smooth muscle ET(A) receptor.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                },
                {
                    "database": "PubMed",
                    "id": "20516397",
                    "url": "https://glygen.org/publication/PubMed/20516397"
                }
            ]
        },
        {
            "annotation": "ESM-1 Mediates Cell Progression in Clear Cell Renal Cell Carcinoma by Affecting Wnt/beta-Catenin Signalling Pathway.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                },
                {
                    "database": "PubMed",
                    "id": "37455528",
                    "url": "https://glygen.org/publication/PubMed/37455528"
                }
            ]
        },
        {
            "annotation": "Endocan is normally present in the mouse brain and prior vascular perfusion with FITC may provide a useful tool for identify newly forming blood vessels.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                },
                {
                    "database": "PubMed",
                    "id": "24055127",
                    "url": "https://glygen.org/publication/PubMed/24055127"
                }
            ]
        },
        {
            "annotation": "Endothelial Cell-Specific Molecule-1 Inhibits Albuminuria in Diabetic Mice. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                },
                {
                    "database": "PubMed",
                    "id": "36591362",
                    "url": "https://glygen.org/publication/PubMed/36591362"
                }
            ]
        },
        {
            "annotation": "Involved in angiogenesis; promotes angiogenic sprouting. May have potent implications in lung endothelial cell-leukocyte interactions (By similarity).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9QYY7",
                    "url": "https://www.uniprot.org/uniprot/Q9QYY7#function"
                }
            ]
        },
        {
            "annotation": "Mouse endocan serum level was measured at a median of 0.96 ng/mL and 1.08 ng/mL in 129Sv mice and C57bl6, respectively.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                },
                {
                    "database": "PubMed",
                    "id": "22370430",
                    "url": "https://glygen.org/publication/PubMed/22370430"
                }
            ]
        },
        {
            "annotation": "Results suggest that endocan (ESM-1)is preferentially expressed in tumor endothelium in vivo and that its expression is regulated by tumor-derived factors.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                },
                {
                    "database": "PubMed",
                    "id": "16956626",
                    "url": "https://glygen.org/publication/PubMed/16956626"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9QYY7",
                    "url": "https://www.uniprot.org/uniprot/Q9QYY7"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Esm1",
            "url": "https://www.uniprot.org/uniprot/Q9QYY7",
            "locus": {
                "chromosome": "13",
                "start_pos": 113354632,
                "end_pos": 113346193,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000042379",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000042379"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000042379",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000042379",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "71690",
            "url": "https://www.ncbi.nlm.nih.gov/gene/71690",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000867",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000867",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR009030",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR009030",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR038850",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR038850",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:71690",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:71690",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1918940",
            "url": "http://www.informatics.jax.org/marker/MGI:1918940",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "TAWSAKY",
            "url": "https://omabrowser.org/oma/group/TAWSAKY/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5341363at2759",
            "url": "http://www.orthodb.org/?query=5341363at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR15428",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15428",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR15428:SF0",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15428:SF0",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00219",
            "url": "http://pfam.xfam.org/family/PF00219",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q9QYY7",
            "url": "http://purl.obolibrary.org/obo/PR_Q9QYY7",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_076101",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9QYY7",
            "url": "https://www.uniprot.org/uniprot/Q9QYY7",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9QYY7-1",
            "url": "https://www.uniprot.org/uniprot/Q9QYY7-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MKSLLLLTTLLVPLHLGMAWSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR",
        "length": 184,
        "header": "sp|Q9QYY7-1|ESM1_MOUSE Isoform 1 of Endothelial cell-specific molecule 1  OS=Mus musculus OX=10090 GN=Esm1 PE=2 SV=1 CANONICAL=Q9QYY7-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q9QYY7-1",
            "url": "",
            "sequence": {
                "sequence": "MKSLLLLTTLLVPLHLGMAWSAKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR",
                "length": 184,
                "header": "sp|Q9QYY7-1|ESM1_MOUSE Isoform 1 of Endothelial cell-specific molecule 1  OS=Mus musculus OX=10090 GN=Esm1 PE=2 SV=1 CANONICAL=Q9QYY7-1"
            },
            "locus": {
                "chromosome": "13",
                "start_pos": 113353271,
                "end_pos": 113346377,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000038144",
                        "url": "https://www.ensembl.org/id/ENSMUST00000038144"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000040187",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000040187"
                    }
                ]
            }
        }
    ],
    "glycosylation": [
        {
            "glytoucan_ac": "",
            "type": "O-linked",
            "subtype": "",
            "site_category": "predicted",
            "site_seq": "S",
            "relation": "attached",
            "comment": "O-linked (Xyl...) (chondroitin sulfate) serine",
            "start_pos": 157,
            "start_aa": "Ser",
            "end_pos": 157,
            "end_aa": "Ser",
            "residue": "Ser",
            "site_lbl": "Ser157",
            "evidence": [
                {
                    "id": "Q9QYY7",
                    "database": "UniProtKB",
                    "url": "https://www.uniprot.org/uniprot/Q9QYY7#ptm_processing"
                }
            ]
        }
    ],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [
        "glycoprotein",
        "glycoprotein_predicted"
    ],
    "publication": [
        {
            "title": "Vascular endocan is preferentially expressed in tumor endothelium.",
            "journal": "Microvascular research",
            "date": "2006",
            "authors": "Abid MR, Yi X, Yano K, Shih SC, Aird WC",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16956626",
                    "url": "https://glygen.org/publication/PubMed/16956626"
                }
            ]
        },
        {
            "title": "Low blood pressure in endothelial cell-specific endothelin 1 knockout mice.",
            "journal": "Hypertension (Dallas, Tex. : 1979)",
            "date": "2010",
            "authors": "Kisanuki YY, Emoto N, Ohuchi T, Widyantoro B, Yagi K, Nakayama K, Kedzierski RM, Hammer RE, Yanagisawa H, Williams SC, Richardson JA, Suzuki T, Yanagisawa M",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "20516397",
                    "url": "https://glygen.org/publication/PubMed/20516397"
                }
            ]
        },
        {
            "title": "Development of monoclonal antibodies and ELISA specific for the mouse vascular endocan.",
            "journal": "Journal of immunological methods",
            "date": "2012",
            "authors": "Depontieu F, de Freitas Caires N, Gourcerol D, Giordano J, Grigoriu B, Delehedde M, Lassalle P",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22370430",
                    "url": "https://glygen.org/publication/PubMed/22370430"
                }
            ]
        },
        {
            "title": "Endocan immunoreactivity in the mouse brain: method for identifying nonfunctional blood vessels.",
            "journal": "Journal of immunological methods",
            "date": "2013",
            "authors": "Frahm KA, Nash CP, Tobet SA",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "24055127",
                    "url": "https://glygen.org/publication/PubMed/24055127"
                }
            ]
        },
        {
            "title": "Endothelial Cell-Specific Molecule-1 Inhibits Albuminuria in Diabetic Mice.",
            "journal": "Kidney360",
            "date": "2022-12-29",
            "authors": "Zheng Xiaoyi, Higdon Lauren, Gaudet Alexandre, Shah Manav, Balistieri Angela, Li Catherine, Nadai Patricia, Palaniappan Latha, Yang Xiaoping, Santo Briana, Ginley Brandon, Wang Xiaoxin X, Myakala Komuraiah, Nallagatla Pratima, Levi Moshe, Sarder Pinaki, Rosenberg Avi, Maltzman Jonathan S, de Freitas Caires Nathalie, Bhalla Vivek",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36591362",
                    "url": "https://glygen.org/publication/PubMed/36591362"
                }
            ]
        },
        {
            "title": "ESM-1 Mediates Cell Progression in Clear Cell Renal Cell Carcinoma by Affecting Wnt/\u03b2-Catenin Signalling Pathway.",
            "journal": "Archivos espanoles de urologia",
            "date": "2023-06",
            "authors": "Liu Xiaoyun, Wang Fengjuan, Du Wen, Yang Xiansong",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_076101",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076101"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "37455528",
                    "url": "https://glygen.org/publication/PubMed/37455528"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:71690",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:71690",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "P97682-1",
            "protein_name": "Endothelial cell-specific molecule 1",
            "gene_name": "Esm1",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MKSLLLLTTLLIPLHLGMAWSAKYAVDCPEHCDNTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGVCKDCPYGTFGMDCKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASQTERDAASGDGNAVREEIGDRNAARPSVMKWLNPR",
                "length": 184
            },
            "evidence": [
                {
                    "id": "45239098",
                    "url": "http://www.informatics.jax.org/homology/45239098",
                    "database": "MGI"
                },
                {
                    "id": "Q9QYY7",
                    "url": "https://omabrowser.org/oma/group/Q9QYY7/",
                    "database": "OMA"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q9NQ30-1",
            "protein_name": "Endothelial cell-specific molecule 1",
            "gene_name": "ESM1",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MKSVLLLTTLLVPAHLVAAWSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR",
                "length": 184
            },
            "evidence": [
                {
                    "id": "45239098",
                    "url": "http://www.informatics.jax.org/homology/45239098",
                    "database": "MGI"
                },
                {
                    "id": "Q9QYY7",
                    "url": "https://omabrowser.org/oma/group/Q9QYY7/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "hepatocyte growth factor receptor binding",
                        "id": "GO:0005171",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005171",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9QYY7",
                                "url": "https://www.uniprot.org/uniprot/Q9QYY7"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "integrin binding",
                        "id": "GO:0005178",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9QYY7",
                                "url": "https://www.uniprot.org/uniprot/Q9QYY7"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 4,
                "go_terms": [
                    {
                        "name": "positive regulation of hepatocyte growth factor receptor signaling pathway",
                        "id": "GO:1902204",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902204",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9QYY7",
                                "url": "https://www.uniprot.org/uniprot/Q9QYY7"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "angiogenesis",
                        "id": "GO:0001525",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9QYY7",
                                "url": "https://www.uniprot.org/uniprot/Q9QYY7"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of cell population proliferation",
                        "id": "GO:0008284",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9QYY7",
                                "url": "https://www.uniprot.org/uniprot/Q9QYY7"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "sprouting angiogenesis",
                        "id": "GO:0002040",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002040",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9QYY7",
                                "url": "https://www.uniprot.org/uniprot/Q9QYY7"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "extracellular region",
                        "id": "GO:0005576",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9QYY7",
                                "url": "https://www.uniprot.org/uniprot/Q9QYY7"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "glytoucan_ac",
                "type",
                "subtype",
                "site_category",
                "site_seq",
                "relation",
                "comment",
                "start_pos",
                "start_aa",
                "end_pos",
                "end_aa",
                "residue",
                "site_lbl"
            ]
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 6
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}