{ "uniprot_canonical_ac": "Q9QXZ9-1", "uniprot_ac": "Q9QXZ9", "uniprot_id": "OPN4_MOUSE", "mass": { "chemical_mass": 57231.0, "monoisotopic_mass": 57231.0 }, "refseq": { "ac": "NP_001122071", "name": "melanopsin isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071" }, "gene_names": [ { "name": "Opn4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9QXZ9", "id": "Q9QXZ9" }, { "name": "1110007J02Rik; Gm533", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071", "id": "NP_001122071" }, { "name": "Mopn", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9QXZ9", "id": "Q9QXZ9" }, { "name": "Mop", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9QXZ9", "id": "Q9QXZ9" }, { "name": "Opn4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071", "id": "NP_001122071" } ], "protein_names": [ { "name": "Melanopsin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9QXZ9" }, { "name": "Opsin-4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QXZ9" }, { "name": "melanopsin isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071", "id": "NP_001122071" }, { "name": "opsin-4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071", "id": "NP_001122071" } ], "function": [ { "annotation": "Critical role in circadian photoentrainment", "evidence": [ { "database": "RefSeq", "id": "NP_001122071", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071" }, { "database": "PubMed", "id": "12481141", "url": "https://glygen.org/publication/PubMed/12481141" } ] }, { "annotation": "Melanopsin (OPN4) is a novel player in skin homeostasis and attenuates UVA-induced effects.", "evidence": [ { "database": "RefSeq", "id": "NP_001122071", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071" }, { "database": "PubMed", "id": "37018912", "url": "https://glygen.org/publication/PubMed/37018912" } ] }, { "annotation": "Melanopsin containing retinal ganglion cell axons project to the suprachiasmatic nucleus and other brain nuclei involved in circadian photoentrainment or the pupillary light reflex", "evidence": [ { "database": "RefSeq", "id": "NP_001122071", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071" }, { "database": "PubMed", "id": "11834834", "url": "https://glygen.org/publication/PubMed/11834834" } ] }, { "annotation": "Melanopsin is not essential for the circadian clock to receive photic input, but it contributes significantly to the magnitude of photic responses", "evidence": [ { "database": "RefSeq", "id": "NP_001122071", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071" }, { "database": "PubMed", "id": "12481140", "url": "https://glygen.org/publication/PubMed/12481140" } ] }, { "annotation": "Photoreceptor that binds cis-retinaldehydes (PubMed:19793992). Contributes to pupillar reflex, photoentrainment and other non-image forming responses to light (PubMed:12808468). May be involved in the optokinetic visual tracking response (PubMed:26392540). May be involved in the regulation of retinal hyaloid vessel growth and regression (PubMed:30936473).", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9#function" }, { "database": "PubMed", "id": "12808468", "url": "https://glygen.org/publication/PubMed/12808468" }, { "database": "PubMed", "id": "26392540", "url": "https://glygen.org/publication/PubMed/26392540" }, { "database": "PubMed", "id": "30936473", "url": "https://glygen.org/publication/PubMed/30936473" }, { "database": "PubMed", "id": "19793992", "url": "https://glygen.org/publication/PubMed/19793992" } ] } ], "disease": [ { "disease_id": "DOID:0110372", "recommended_name": { "id": "DOID:0110372", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110372", "name": "retinitis pigmentosa 4", "description": "A retinitis pigmentosa that has_material_basis_in mutation in the RHO gene on chromosome 3q22." }, "synonyms": [ { "id": "DOID:0110372", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110372", "name": "RP4", "description": "" }, { "id": "MONDO:0013395", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013395", "name": "retinitis pigmentosa 4", "description": "Any retinitis pigmentosa in which the cause of the disease is a mutation in the RHO gene." }, { "id": "MONDO:0013395", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013395", "name": "RHO retinitis pigmentosa", "description": "" }, { "id": "MONDO:0013395", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013395", "name": "RP4", "description": "" }, { "id": "MONDO:0013395", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013395", "name": "retinitis pigmentosa 4", "description": "" }, { "id": "MONDO:0013395", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013395", "name": "retinitis pigmentosa 4, autosomal dominant or recessive", "description": "" }, { "id": "MONDO:0013395", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013395", "name": "retinitis pigmentosa caused by mutation in RHO", "description": "" }, { "id": "MONDO:0013395", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013395", "name": "retinitis pigmentosa type 4", "description": "" }, { "id": "MONDO:0013395", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013395", "name": "RP 4", "description": "" }, { "id": "MONDO:0013395", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013395", "name": "retinitis pigmentosa, rhodopsin-related", "description": "" }, { "id": "MIM:613731", "resource": "MIM", "url": "https://www.omim.org/entry/613731", "name": "Retinitis pigmentosa 4", "description": "Retinitis pigmentosa 4" } ], "evidence": [ { "id": "0110372", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110372" } ] }, { "disease_id": "DOID:10003", "recommended_name": { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "sensorineural hearing loss", "description": "An inner ear disease that is characterized by hearing loss resulting from damage to the cochlea, auditory nerve and/or brainstem." }, "synonyms": [ { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "High Frequency Hearing Loss", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "High frequency deafness", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "Perceptive deafness", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "Perceptive hearing loss", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "Perceptive hearing loss or deafness", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "Sensorineural Deafness", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "Sensory hearing loss", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "central hearing loss", "description": "" }, { "id": "DOID:10003", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10003", "name": "high-frequency hearing loss", "description": "" } ], "evidence": [ { "id": "10003", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10003" } ] }, { "disease_id": "DOID:10584", "recommended_name": { "id": "DOID:10584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10584", "name": "retinitis pigmentosa", "description": "A retinal degeneration characterized by the gradual deterioration of the photoreceptors or the retinal pigment epithelium of the retina leading to progressive sight loss." }, "synonyms": [ { "id": "DOID:10584", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10584", "name": "pericentral pigmentary retinopathy", "description": "" }, { "id": "MONDO:0019200", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019200", "name": "retinitis pigmentosa", "description": "Retinitis pigmentosa (RP) is an inherited retinal dystrophy leading to progressive loss of the photoreceptors and retinal pigment epithelium and resulting in blindness usually after several decades." }, { "id": "MONDO:0019200", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019200", "name": "retinitis pigmentosa", "description": "" }, { "id": "MONDO:0019200", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019200", "name": "pericentral pigmentary retinopathy", "description": "" }, { "id": "MONDO:0019200", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0019200", "name": "Rod-cone dystrophy", "description": "" }, { "id": "MIM:268000", "resource": "MIM", "url": "https://www.omim.org/entry/268000", "name": "Retinitis pigmentosa", "description": "Retinitis pigmentosa" } ], "evidence": [ { "id": "10584", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10584" } ] }, { "disease_id": "DOID:5679", "recommended_name": { "id": "DOID:5679", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5679", "name": "retinal disease", "description": "An eye disease that is located_in the retina." }, "synonyms": [], "evidence": [ { "id": "5679", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:5679" } ] }, { "disease_id": "DOID:8466", "recommended_name": { "id": "DOID:8466", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8466", "name": "retinal degeneration", "description": "A retinal disease that is characterized by deterioration of the retina caused by the progressive and eventual death of the cells of the retina." }, "synonyms": [ { "id": "DOID:8466", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:8466", "name": "degeneration of retina", "description": "" } ], "evidence": [ { "id": "8466", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:8466" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Opn4", "url": "https://www.uniprot.org/uniprot/Q9QXZ9", "locus": { "chromosome": "14", "start_pos": 34312575, "end_pos": 34322099, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000021799", "url": "https://www.ensembl.org/id/ENSMUSG00000021799" } ] } } ], "crossref": [ { "id": "ENSMUSG00000021799", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000021799", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "30044", "url": "https://www.ncbi.nlm.nih.gov/gene/30044", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9QXZ9", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9QXZ9*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001760", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001760", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027430", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027430", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:30044", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:30044", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1353425", "url": "http://www.informatics.jax.org/marker/MGI:1353425", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "WKMAKIV", "url": "https://omabrowser.org/oma/group/WKMAKIV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3432893at2759", "url": "http://www.orthodb.org/?query=3432893at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24240", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24240", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24240:SF72", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24240:SF72", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "http://pfam.xfam.org/family/PF00001", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9QXZ9", "url": "http://purl.obolibrary.org/obo/PR_Q9QXZ9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-416476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-419771", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-419771", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001122071", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QXZ9-1", "url": "https://www.uniprot.org/uniprot/Q9QXZ9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QXZ9-2", "url": "https://www.uniprot.org/uniprot/Q9QXZ9-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDSPSGPRVLSSLTQDPSFTTSPALQGIWNGTQNVSVRAQLLSVSPTTSAHQAAAWVPFPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMSVTQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIRETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWISGRKRQESLGSESEVGWTDTETTAAWGAAQQASGQSFCSQNLEDGELKASSSPQVQRSKTPKVPGPSTCRPMKGQGARPSSLRGDQKGRLAVCTGLSECPHPHTSQFPLAFLEDDVTLRHL", "length": 521, "header": "sp|Q9QXZ9-1|OPN4_MOUSE Isoform 1 of Melanopsin OS=Mus musculus OX=10090 GN=Opn4 PE=1 SV=1 CANONICAL=Q9QXZ9-1" }, "isoforms": [ { "isoform_ac": "Q9QXZ9-1", "url": "", "sequence": { "sequence": "MDSPSGPRVLSSLTQDPSFTTSPALQGIWNGTQNVSVRAQLLSVSPTTSAHQAAAWVPFPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMSVTQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIRETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWISGRKRQESLGSESEVGWTDTETTAAWGAAQQASGQSFCSQNLEDGELKASSSPQVQRSKTPKVPGPSTCRPMKGQGARPSSLRGDQKGRLAVCTGLSECPHPHTSQFPLAFLEDDVTLRHL", "length": 521, "header": "sp|Q9QXZ9-1|OPN4_MOUSE Isoform 1 of Melanopsin OS=Mus musculus OX=10090 GN=Opn4 PE=1 SV=1 CANONICAL=Q9QXZ9-1" }, "locus": { "chromosome": "14", "start_pos": 34321915, "end_pos": 34314709, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000022331", "url": "https://www.ensembl.org/id/ENSMUST00000022331" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000022331", "url": "https://www.ensembl.org/id/ENSMUSP00000022331" } ] } }, { "isoform_ac": "Q9QXZ9-2", "url": "", "sequence": { "sequence": "MDSPSGPRVLSSLTQDPSFTTSPALQGIWNGTQNVSVRAQLLSVSPTTSAHQAAAWVPFPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMSVTQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGRGSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIRETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWISGRKRQESLGSESEVGWTDTETTAAWGAAQQASGQSFCSQNLEDGELKASSSPQTKGHLPSLDLGM", "length": 466, "header": "sp|Q9QXZ9-2|OPN4_MOUSE Isoform 2 of Melanopsin OS=Mus musculus OX=10090 GN=Opn4 PE=1 SV=1 CANONICAL=Q9QXZ9-1" }, "locus": { "chromosome": "14", "start_pos": 34321915, "end_pos": 34313252, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000168444", "url": "https://www.ensembl.org/id/ENSMUST00000168444" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000126136", "url": "https://www.ensembl.org/id/ENSMUSP00000126136" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 30, "start_aa": "Asn", "end_pos": 30, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn30", "evidence": [ { "id": "Q9QXZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXZ9#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 34, "start_aa": "Asn", "end_pos": 34, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn34", "evidence": [ { "id": "Q9QXZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXZ9#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 186, "end_pos": 186, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9QXZ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QXZ9" }, { "database": "PubMed", "id": "23049792", "url": "https://glygen.org/publication/PubMed/23049792" } ], "site_lbl": "Thr186" }, { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9QXZ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QXZ9" }, { "database": "PubMed", "id": "23049792", "url": "https://glygen.org/publication/PubMed/23049792" } ], "site_lbl": "Ser287" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "A novel human opsin in the inner retina.", "journal": "J. Neurosci.", "date": "2000", "authors": "Provencio I, Rodriguez IR, Jiang G, Hayes WP, Moreira EF, Rollag MD", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "reference": [ { "type": "PubMed", "id": "10632589", "url": "https://glygen.org/publication/PubMed/10632589" } ] }, { "title": "Melanopsin-containing retinal ganglion cells: architecture, projections, and intrinsic photosensitivity.", "journal": "Science", "date": "2002", "authors": "Hattar S, Liao HW, Takao M, Berson DM, Yau KW", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" }, { "database": "RefSeq", "id": "NP_001122071", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071" } ], "reference": [ { "type": "PubMed", "id": "11834834", "url": "https://glygen.org/publication/PubMed/11834834" } ] }, { "title": "Role of melanopsin in circadian responses to light.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Ruby NF, Brennan TJ, Xie X, Cao V, Franken P, Heller HC, O'Hara BF", "evidence": [ { "database": "RefSeq", "id": "NP_001122071", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071" } ], "reference": [ { "type": "PubMed", "id": "12481140", "url": "https://glygen.org/publication/PubMed/12481140" } ] }, { "title": "Melanopsin (Opn4) requirement for normal light-induced circadian phase shifting.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Panda S, Sato TK, Castrucci AM, Rollag MD, DeGrip WJ, Hogenesch JB, Provencio I, Kay SA", "evidence": [ { "database": "RefSeq", "id": "NP_001122071", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071" } ], "reference": [ { "type": "PubMed", "id": "12481141", "url": "https://glygen.org/publication/PubMed/12481141" } ] }, { "title": "Melanopsin and rod-cone photoreceptive systems account for all major accessory visual functions in mice.", "journal": "Nature", "date": "2003", "authors": "Hattar S, Lucas RJ, Mrosovsky N, Thompson S, Douglas RH, Hankins MW, Lem J, Biel M, Hofmann F, Foster RG, Yau KW", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "reference": [ { "type": "PubMed", "id": "12808468", "url": "https://glygen.org/publication/PubMed/12808468" } ] }, { "title": "Differential expression of two distinct functional isoforms of melanopsin (Opn4) in the mammalian retina.", "journal": "J. Neurosci.", "date": "2009", "authors": "Zheng L., Cheetham M.E., Halford S., Bellingham J., Kosmaoglou M., Foster R.G., Hankins M.W., Lucas R.J., Melyan Z., Hughes S., Peirson S.N., Pires S.S., Turton M.", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "reference": [ { "type": "PubMed", "id": "19793992", "url": "https://glygen.org/publication/PubMed/19793992" } ] }, { "title": "Phosphorylation of mouse melanopsin by protein kinase A.", "journal": "PloS one", "date": "2012", "authors": "Blasic JR Jr, Brown RL, Robinson PR", "evidence": [ { "database": "iPTMnet", "id": "Q9QXZ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QXZ9" } ], "reference": [ { "type": "PubMed", "id": "23049792", "url": "https://glygen.org/publication/PubMed/23049792" } ] }, { "title": "Neuropsin (OPN5)-mediated photoentrainment of local circadian oscillators in mammalian retina and cornea.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2015", "authors": "Buhr ED, Yue WW, Ren X, Jiang Z, Liao HW, Mei X, Vemaraju S, Nguyen MT, Reed RR, Lang RA, Yau KW, Van Gelder RN", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "reference": [ { "type": "PubMed", "id": "26392540", "url": "https://glygen.org/publication/PubMed/26392540" } ] }, { "title": "Impaired Circadian Photoentrainment in Opn5-Null Mice.", "journal": "IScience", "date": "2018", "authors": "Yoshimura T., Nakane Y., Hattar S., Ota W.", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "reference": [ { "type": "PubMed", "id": "30240620", "url": "https://glygen.org/publication/PubMed/30240620" } ] }, { "title": "An opsin 5-dopamine pathway mediates light-dependent vascular development in the eye.", "journal": "Nat. Cell Biol.", "date": "2019", "authors": "Nguyen MT, Vemaraju S, Nayak G, Odaka Y, Buhr ED, Alonzo N, Tran U, Batie M, Upton BA, Darvas M, Kozmik Z, Rao S, Hegde RS, Iuvone PM, Van Gelder RN, Lang RA", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "reference": [ { "type": "PubMed", "id": "30936473", "url": "https://glygen.org/publication/PubMed/30936473" } ] }, { "title": "Neuropsin (OPN5) Mediates Local Light-Dependent Induction of Circadian Clock Genes and Circadian Photoentrainment in Exposed Murine Skin.", "journal": "Curr. Biol.", "date": "2019", "authors": "Buhr ED, Vemaraju S, Diaz N, Lang RA, Van Gelder RN", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "reference": [ { "type": "PubMed", "id": "31607531", "url": "https://glygen.org/publication/PubMed/31607531" } ] }, { "title": "Melanopsin (OPN4) is a novel player in skin homeostasis and attenuates UVA-induced effects.", "journal": "Journal of photochemistry and photobiology. B, Biology", "date": "2023-05", "authors": "Sua-Cespedes Cristhian, Lacerda Jos\u00e9 Thalles, Zanetti Giovanna, David Daniela Dantas, Moraes Maria Nathalia, de Assis Leonardo V M, Castrucci Ana Maria L", "evidence": [ { "database": "RefSeq", "id": "NP_001122071", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001122071" } ], "reference": [ { "type": "PubMed", "id": "37018912", "url": "https://glygen.org/publication/PubMed/37018912" } ] } ], "pathway": [ { "id": "mmu:30044", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:30044", "resource": "KEGG Pathway" }, { "id": "R-MMU-416476", "name": "G alpha (q) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-416476", "resource": "Reactome", "description": "G alpha (q) signalling events" }, { "id": "R-MMU-419771", "name": "Opsins", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-419771", "resource": "Reactome", "description": "Opsins" } ], "orthologs": [ { "uniprot_canonical_ac": "P08099-1", "protein_name": "Opsin Rh2", "gene_name": "Rh2", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MERSHLPETPFDLAHSGPRFQAQSSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKILGLFTLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPLWCDIYAGCGSLFGCVSIWSMCMIAFDRYNVIVKGINGTPMTIKTSIMKILFIWMMAVFWTVMPLIGWSAYVPEGNLTACSIDYMTRMWNPRSYLITYSLFVYYTPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAWTPYLVICYFGLFKIDGLTPLTTIWGATFAKTSAVYNPIVYGISHPKYRIVLKEKCPMCVFGNTDEPKPDAPASDTETTSEADSKA", "length": 381 }, "evidence": [ { "id": "Q9QXZ9", "url": "https://omabrowser.org/oma/group/Q9QXZ9/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8R456-1", "protein_name": "Melanopsin", "gene_name": "Opn4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNSPSESRVPSSLTQDPSFTASPALLQGIWNSTQNISVRVQLLSVSPTTPGLQAAAWVPFPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMLIINLAVSDFLMSFTQAPVFFASSLYKKWLFGETGCKFYAFCGAVFGIVSMITLTAIAMDRYLVITRPLATIGMRSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYVTFTPLVRAYTMLLFCFVFFLPLLIIIFCYIFIFRAIRETGRACEGCGESPLRRRQWQRLQSEWKMAKVALIVILLFVLSWAPYSTVALVGFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRAAIAQHLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWISGQKRQESLGSESEVGWTDTETTAAWGAAQQASGQSFCSHDLEDGEVKAPSSPQEQKSKTPKTKRHLPSLDRRM", "length": 474 }, "evidence": [ { "id": "45225175", "url": "http://www.informatics.jax.org/homology/45225175", "database": "MGI" }, { "id": "Q9QXZ9", "url": "https://omabrowser.org/oma/group/Q9QXZ9/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9UHM6-1", "protein_name": "Melanopsin", "gene_name": "OPN4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNPPSGPRVPPSPTQEPSCMATPAPPSWWDSSQSSISSLGRLPSISPTAPGTWAAAWVPLPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMSFTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFGVASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLCCFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLLVILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGWTHMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM", "length": 478 }, "evidence": [ { "id": "45225175", "url": "http://www.informatics.jax.org/homology/45225175", "database": "MGI" }, { "id": "Q9QXZ9", "url": "https://omabrowser.org/oma/group/Q9QXZ9/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "hyaloid vascular plexus regression", "id": "GO:1990384", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990384", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "visual perception", "id": "GO:0007601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007601", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "regulation of circadian rhythm", "id": "GO:0042752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042752", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "rhythmic process", "id": "GO:0048511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048511", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "phototransduction", "id": "GO:0007602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007602", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "cellular response to light stimulus", "id": "GO:0071482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071482", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "optokinetic behavior", "id": "GO:0007634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007634", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "detection of temperature stimulus involved in thermoception", "id": "GO:0050960", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050960", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "thermotaxis", "id": "GO:0043052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043052", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "perikaryon", "id": "GO:0043204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043204", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "sperm head plasma membrane", "id": "GO:1990913", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990913", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "11-cis retinal binding", "id": "GO:0005502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005502", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" }, { "name": "G protein-coupled photoreceptor activity", "id": "GO:0008020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008020", "evidence": [ { "database": "UniProtKB", "id": "Q9QXZ9", "url": "https://www.uniprot.org/uniprot/Q9QXZ9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 30, "end_pos": 32, "annotation": "n_glycosylation_sequon" }, { "start_pos": 34, "end_pos": 36, "annotation": "n_glycosylation_sequon" }, { "start_pos": 87, "end_pos": 89, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }