{ "uniprot_canonical_ac": "Q9QXK2-1", "uniprot_ac": "Q9QXK2", "uniprot_id": "RAD18_MOUSE", "mass": { "chemical_mass": 57412.0, "monoisotopic_mass": 57412.0 }, "refseq": {}, "gene_names": [ { "name": "Rad18", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9QXK2", "id": "Q9QXK2" }, { "name": "Rad18sc", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9QXK2", "id": "Q9QXK2" } ], "protein_names": [ { "name": "E3 ubiquitin-protein ligase RAD18", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9QXK2" }, { "name": "2.3.2.27", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QXK2" }, { "name": "Postreplication repair protein RAD18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QXK2" }, { "name": "RING-type E3 ubiquitin transferase RAD18", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QXK2" }, { "name": "mRAD18Sc", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QXK2" } ], "function": [ { "annotation": "E3 ubiquitin-protein ligase involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA. Associates to the E2 ubiquitin conjugating enzyme UBE2B to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. Has ssDNA binding activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Rad18", "url": "https://www.uniprot.org/uniprot/Q9QXK2", "locus": { "chromosome": "6", "start_pos": 112596811, "end_pos": 112673647, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000030254", "url": "https://www.ensembl.org/id/ENSMUSG00000030254" } ] } } ], "crossref": [ { "id": "ENSMUSG00000030254", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000030254", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16529", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16529", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "Q9QXK2", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9QXK2*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006642", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006642", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017907", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017907", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036361", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036361", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039577", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039577", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:58186", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:58186", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1890476", "url": "http://www.informatics.jax.org/marker/MGI:1890476", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "ERTQGGH", "url": "https://omabrowser.org/oma/group/ERTQGGH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "6177at2759", "url": "http://www.orthodb.org/?query=6177at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14134", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14134", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14134:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14134:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02037", "url": "http://pfam.xfam.org/family/PF02037", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13923", "url": "http://pfam.xfam.org/family/PF13923", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9QXK2", "url": "http://purl.obolibrary.org/obo/PR_Q9QXK2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-110314", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110314", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8866654", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8866654", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "D3Z733", "url": "https://www.uniprot.org/uniprot/D3Z733", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z733-1", "url": "https://www.uniprot.org/uniprot/D3Z733-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z734", "url": "https://www.uniprot.org/uniprot/D3Z734", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z734-1", "url": "https://www.uniprot.org/uniprot/D3Z734-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q392", "url": "https://www.uniprot.org/uniprot/E9Q392", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q392-1", "url": "https://www.uniprot.org/uniprot/E9Q392-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6ZKR0", "url": "https://www.uniprot.org/uniprot/F6ZKR0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6ZKR0-1", "url": "https://www.uniprot.org/uniprot/F6ZKR0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QXK2-1", "url": "https://www.uniprot.org/uniprot/Q9QXK2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "W4VSP9", "url": "https://www.uniprot.org/uniprot/W4VSP9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "W4VSP9-1", "url": "https://www.uniprot.org/uniprot/W4VSP9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEVLAEPRWPPGLAVMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMNFARTHLLQFALESPPISPVSSTSKKVVVKVHNADAAQHPVKQANRLMDKFLIRETGDCVFELLGKENERKFSPQKELSTSAEIKETSLLGKPVLGLSDANGPVTPSTSTMKLDTKVSCPVCGVSIPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQYGLSVQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIESMEKTRMRLEASKLNENVMVFTKNQTEKEIEEVHSEYRKKHQNAFQLLVDQAKKGYKKTGRVSQAAAMRTDEPAETLPSMRTDEPAETLPSMRTDEPAETLPLMRADEPAETLPSECIAQEDNVSFSDTVSVTNHFPQPQLDSPGPSEPERPDDSSSCTDILFSSDSDSCNRNDQNREVSPQQTRRTRASECVEIEPRNKRNKN", "length": 509, "header": "sp|Q9QXK2-1|RAD18_MOUSE Isoform 1 of E3 ubiquitin-protein ligase RAD18 OS=Mus musculus OX=10090 GN=Rad18 PE=1 SV=2 CANONICAL=Q9QXK2-1" }, "isoforms": [ { "isoform_ac": "D3Z733-1", "url": "", "sequence": { "sequence": "MEVLAEPRWPPGLAVMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMNFARTHLLQFALESPPISPVSSTSKKVVVKVHNADAAQHPVKQANRLMDKFLIRETGDCVFELLGKENERKFSPQKELSTSAEIKETSLLGKPVLGLSDANGPVTPSTSTMKLDTKVSCPVCGVSIPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQYGLSVQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIESMEKTRMRLEASKLNENVMVFTKNQTEKEIEEVHSEYPQEDNVSFSDTVSVTNHFPQPQLDSPGPSEPERPDDSSSCTDILFSSDSDSCNSSSSDIIRDLLEEEEAWEAAHKNDQNREVSPQQTRRTRASECVEIEPRNKRNKN", "length": 449, "header": "tr|D3Z733-1|RAD18_MOUSE Computationally mapped isoform of E3 ubiquitin-protein ligase RAD18 OS=Mus musculus OX=10090 GN=Rad18 PE=1 SV=1 CANONICAL=Q9QXK2-1" }, "locus": { "chromosome": "6", "start_pos": 112673555, "end_pos": 112597769, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000113182.8", "url": "https://www.ensembl.org/id/ENSMUST00000113182.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000108807.2", "url": "https://www.ensembl.org/id/ENSMUSP00000108807.2" } ] } }, { "isoform_ac": "D3Z734-1", "url": "", "sequence": { "sequence": "MEVLAEPRWPPGLAVMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMNFARTHLLQFALESPPISPVSSTSKKVVVKVHNADAAQHPVKQANRLMDKFLIRETGDCVFELLGKENERKFSPQKELSTSAEIKETSLLGKPVLGLSDANGPVTPSTSTMKLDTKVSCPVCGVSIPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQYGLSVQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIESMEKTRMRLEASKLNENVMVFTKNQTEKEIEEVHSEYPQEDNVSFSDTVSVTNHFPQPQLDSPGPSEPERPDDSSSCTDILFSSDSDSCNRNDQNREVSPQQTRRTRASECVEIEPRNKRNKN", "length": 428, "header": "tr|D3Z734-1|RAD18_MOUSE Computationally mapped isoform of E3 ubiquitin-protein ligase RAD18 OS=Mus musculus OX=10090 GN=Rad18 PE=1 SV=1 CANONICAL=Q9QXK2-1" }, "locus": { "chromosome": "6", "start_pos": 112673555, "end_pos": 112597769, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000113180.8", "url": "https://www.ensembl.org/id/ENSMUST00000113180.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000108805.2", "url": "https://www.ensembl.org/id/ENSMUSP00000108805.2" } ] } }, { "isoform_ac": "E9Q392-1", "url": "", "sequence": { "sequence": "MEVLAEPRWPPGLAVMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMNFARTHLLQFALESPPISPVSSTSKKVVVKVHNADAAQHPVKQANRLMDKFLIRETGDCVFELLGKENERKFSPQKELSTSAEIKETSLLGKPVLGLSDANGPVTPSTSTMKLDTKVSCPVCGVSIPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQYGLSVQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIESMEKTRMRLEASKLNENVMVFTKNQTEKEIEEVHSEYHAGKQVAQGCVSENKMRSTIVCWQLSGKKHQNAFQLLVDQAKKGYKKTGRVSQAAAMRTDEPAETLPSMRTDEPAETLPSMRTDEPAETLPLMRADEPAETLPSECIAQEDNVSFSDTVSVTNHFPQPQLDSPGPSEPERPDDSSSCTDILFSSDSDSCNSSSSDIIRDLLEEEEAWEAAHKNDQNREVSPQQTRRTRASECVEIEPRNKRNKN", "length": 556, "header": "tr|E9Q392-1|RAD18_MOUSE Computationally mapped isoform of E3 ubiquitin-protein ligase RAD18 OS=Mus musculus OX=10090 GN=Rad18 PE=1 SV=1 CANONICAL=Q9QXK2-1" }, "locus": { "chromosome": "6", "start_pos": 112673555, "end_pos": 112597769, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000068487.12", "url": "https://www.ensembl.org/id/ENSMUST00000068487.12" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000070619.6", "url": "https://www.ensembl.org/id/ENSMUSP00000070619.6" } ] } }, { "isoform_ac": "F6ZKR0-1", "url": "", "sequence": { "sequence": "AQCDALHPKSAAEIVQEIESMEKTRMRLEASKLNENVMVFTKNQTEKEIEEVHSEYHAGKQVAQGCVSENKMRSTIVCWQLSGKKHQNAFQLLVDQAKKGYKKTGRVSQAAAMRTDEPAETLPSMRTDEPAETLPSMRTDEPAETLPLMRADEPAETLPSECIAQEDNVSFSDTVSVTNHFPQPQLDSPGPSEPERPDDSSSCTDILFSSDSDSCNRNDQNREVSPQQTRRTRASECVEIE", "length": 241, "header": "tr|F6ZKR0-1|RAD18_MOUSE Computationally mapped isoform of E3 ubiquitin-protein ligase RAD18 OS=Mus musculus OX=10090 GN=Rad18 PE=1 SV=1 CANONICAL=Q9QXK2-1" }, "locus": { "chromosome": "6", "start_pos": 112652737, "end_pos": 112597793, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000142079.2", "url": "https://www.ensembl.org/id/ENSMUST00000142079.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000117582.2", "url": "https://www.ensembl.org/id/ENSMUSP00000117582.2" } ] } }, { "isoform_ac": "Q9QXK2-1", "url": "", "sequence": { "sequence": "MEVLAEPRWPPGLAVMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMNFARTHLLQFALESPPISPVSSTSKKVVVKVHNADAAQHPVKQANRLMDKFLIRETGDCVFELLGKENERKFSPQKELSTSAEIKETSLLGKPVLGLSDANGPVTPSTSTMKLDTKVSCPVCGVSIPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQYGLSVQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVQEIESMEKTRMRLEASKLNENVMVFTKNQTEKEIEEVHSEYRKKHQNAFQLLVDQAKKGYKKTGRVSQAAAMRTDEPAETLPSMRTDEPAETLPSMRTDEPAETLPLMRADEPAETLPSECIAQEDNVSFSDTVSVTNHFPQPQLDSPGPSEPERPDDSSSCTDILFSSDSDSCNRNDQNREVSPQQTRRTRASECVEIEPRNKRNKN", "length": 509, "header": "sp|Q9QXK2-1|RAD18_MOUSE Isoform 1 of E3 ubiquitin-protein ligase RAD18 OS=Mus musculus OX=10090 GN=Rad18 PE=1 SV=2 CANONICAL=Q9QXK2-1" }, "locus": { "chromosome": "6", "start_pos": 112673555, "end_pos": 112597769, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000077088", "url": "https://www.ensembl.org/id/ENSMUST00000077088" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000076341", "url": "https://www.ensembl.org/id/ENSMUSP00000076341" } ] } }, { "isoform_ac": "W4VSP9-1", "url": "", "sequence": { "sequence": "MEVLAEPRWPPGLAVMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEPDLRNNRLLDELVKSMNFARTHLLQFALESPPISPVSSTSKKVVVKVHNADAAQHPVKQANRLMDKFLIRETGDCVFELLGKENERKFSPQKELSTSAEIKETSLLGKPVLGLSDANGPVTPSTSTMKLDTKVSCPVCGVSIPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQYGLSVQGNKQQLIKRHQEFVHMYNAQCDALHPKSGHGFYKEPNREGN", "length": 309, "header": "tr|W4VSP9-1|RAD18_MOUSE Computationally mapped isoform of E3 ubiquitin-protein ligase RAD18 OS=Mus musculus OX=10090 GN=Rad18 PE=1 SV=1 CANONICAL=Q9QXK2-1" }, "locus": { "chromosome": "6", "start_pos": 112673555, "end_pos": 112642262, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000156063.2", "url": "https://www.ensembl.org/id/ENSMUST00000156063.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000138558.2", "url": "https://www.ensembl.org/id/ENSMUSP00000138558.2" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 103, "end_pos": 103, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9QXK2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QXK2" } ], "site_lbl": "Ser103" }, { "start_pos": 158, "end_pos": 158, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "site_lbl": "Ser158" }, { "start_pos": 164, "end_pos": 164, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "site_lbl": "Ser164" }, { "start_pos": 485, "end_pos": 485, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "site_lbl": "Ser485" }, { "start_pos": 99, "end_pos": 99, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9QXK2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QXK2" } ], "site_lbl": "Ser99" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Characterization of mRAD18Sc, a mouse homolog of the yeast postreplication repair gene RAD18.", "journal": "Genomics", "date": "2000", "authors": "van der Laan R, Roest HP, Hoogerbrugge JW, Smit EM, Slater R, Baarends WM, Hoeijmakers JH, Grootegoed JA", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "reference": [ { "type": "PubMed", "id": "11013078", "url": "https://glygen.org/publication/PubMed/11013078" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" }, { "database": "iPTMnet", "id": "Q9QXK2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QXK2" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] } ], "pathway": [ { "id": "mmu:58186", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:58186", "resource": "KEGG Pathway" }, { "id": "R-MMU-110314", "name": "Recognition of DNA damage by PCNA-containing replication complex", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-110314", "resource": "Reactome", "description": "Recognition of DNA damage by PCNA-containing replication complex" }, { "id": "R-MMU-8866654", "name": "E3 ubiquitin ligases ubiquitinate target proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8866654", "resource": "Reactome", "description": "E3 ubiquitin ligases ubiquitinate target proteins" } ], "orthologs": [ { "uniprot_canonical_ac": "P10862-1", "protein_name": "Postreplication repair E3 ubiquitin-protein ligase RAD18", "gene_name": "RAD18", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MDHQITTASDFTTTSIPSLYQLDTLLRCHICKDFLKVPVLTPCGHTFCSLCIRTHLNNQPNCPLCLFEFRESLLRSEFLVSEIIQSYTSLRSSLLDALRIPKPTPVPENEEVPGPENSSWIELISESESDSVNAADDDLQIVATSERKLAKRSMTDILPLSSKPSKRNFAMFRSERIKKKSKPNEQMAQCPICQQFYPLKALEKTHLDECLTLQSLGKKPKISTTFPTESNPHNKSSSRFKVRTPEVDKSSCGETSHVDKYLNSMMSAEHQRLPKINFTSMTQSQIKQKLSSLGLSTNGTRQNMIKRYNHYEMLWNSNFCDSLEPVDEAELKRQLLSWDVSHNKTPQNSSNKGGISKLMIMKSNGKSSSYRKLLENFKNDKFNRKGWMVMFRKDFARLIREAKMKIKTGSSDSSGSVGHSNDGDGVEKVQSDQGTEDQQMEKDQDTVINEDRVAGERNLPNEDSTDADLSRELMDLNEYSKDPPGNN", "length": 487 }, "evidence": [ { "id": "Q9QXK2", "url": "https://omabrowser.org/oma/group/Q9QXK2/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q9NS91-1", "protein_name": "E3 ubiquitin-protein ligase RAD18", "gene_name": "RAD18", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN", "length": 495 }, "evidence": [ { "id": "Q9QXK2", "url": "https://omabrowser.org/oma/group/Q9QXK2/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "positive regulation of chromosome segregation", "id": "GO:0051984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051984", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "protein autoubiquitination", "id": "GO:0051865", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051865", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "postreplication repair", "id": "GO:0006301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006301", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "protein monoubiquitination", "id": "GO:0006513", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006513", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "regulation of macromolecule metabolic process", "id": "GO:0060255", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060255", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "response to UV", "id": "GO:0009411", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009411", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "negative regulation of DNA recombination", "id": "GO:0045910", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045910", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 12, "go_terms": [ { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "nuclear body", "id": "GO:0016604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "site of double-strand break", "id": "GO:0035861", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035861", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "replication fork", "id": "GO:0005657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005657", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "nuclear inclusion body", "id": "GO:0042405", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042405", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "male germ cell nucleus", "id": "GO:0001673", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001673", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "Rad6-Rad18 complex", "id": "GO:0097505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097505", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "XY body", "id": "GO:0001741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001741", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 9, "go_terms": [ { "name": "polyubiquitin modification-dependent protein binding", "id": "GO:0031593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031593", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "single-stranded DNA binding", "id": "GO:0003697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "Y-form DNA binding", "id": "GO:0000403", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000403", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" }, { "name": "molecular function inhibitor activity", "id": "GO:0140678", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140678", "evidence": [ { "database": "UniProtKB", "id": "Q9QXK2", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 329, "end_pos": 331, "annotation": "n_glycosylation_sequon" }, { "start_pos": 428, "end_pos": 430, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-MMU-5652005", "name": "RAD18:UBE2B or RBX1:CUL4:DDB1:DTL ubiquitin ligase complex binds PCNA:POLD,POLE:RPA:RFC associated with damaged dsDNA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P63147-1", "P52431-1", "Q9WVF7-1", "P62878-1", "Q9QXK2-1" ], "evidence": [ { "id": "R-MMU-5652005", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5652005" } ] }, { "id": "R-MMU-5652009", "name": "RAD18:UBE2B or RBX1:CUL4:DDB1:DTL monoubiquitinates PCNA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P63147-1", "P52431-1", "Q9WVF7-1", "P62878-1", "Q9QXK2-1" ], "evidence": [ { "id": "R-MMU-5652009", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5652009" } ] }, { "id": "R-MMU-8943003", "name": "SHPRH polyubiquitinates monoubiquitinated PCNA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q7TPQ3-1", "P61089-1", "P63147-1", "Q9QXK2-1" ], "evidence": [ { "id": "R-MMU-8943003", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8943003" } ] }, { "id": "R-MMU-8943007", "name": "SHPRH binds monoUb-K164-PCNA, RAD6:RAD18, UBE2V2:Ub:UBE2N", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q7TPQ3-1", "P61089-1", "P63147-1", "Q9QXK2-1" ], "evidence": [ { "id": "R-MMU-8943007", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8943007" } ] }, { "id": "R-MMU-8943040", "name": "HLTF polyubiquitinates monoubiquitinated PCNA", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61089-1", "P63147-1", "Q6PCN7-1", "Q9QXK2-1" ], "evidence": [ { "id": "R-MMU-8943040", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8943040" } ] }, { "id": "R-MMU-8943041", "name": "HLTF binds monoUb-K164-PCNA, RAD6:RAD18, UBE2V2:Ub:UBE2N", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P61089-1", "P63147-1", "Q6PCN7-1", "Q9QXK2-1" ], "evidence": [ { "id": "R-MMU-8943041", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8943041" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P52431", "gene_name": "Pold1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P52431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52431" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P52431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52431" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P52431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52431" } ] } ] }, { "uniprot_ac": "P61089", "gene_name": "Ube2n", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P61089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61089" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P61089", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61089" } ] } ] }, { "uniprot_ac": "P62878", "gene_name": "Rbx1", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] }, { "ec_number": "2.3.2.32", "activity": "S-[NEDD8-protein]-yl-[E2 NEDD8-conjugating enzyme]-L-cysteine + [cullin]-L-lysine = [E2 NEDD8-conjugating enzyme]-L-cysteine + N(6)-[NEDD8-protein]-yl-[cullin]-L-lysine.", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] }, { "ec_number": "2.3.2.32", "activity": "", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "P62878", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62878" } ] } ] }, { "uniprot_ac": "P63147", "gene_name": "Ube2b", "activity": [ { "ec_number": "2.3.2.23", "activity": "S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.", "evidence": [ { "id": "P63147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63147" } ] }, { "ec_number": "2.3.2.23", "activity": "", "evidence": [ { "id": "P63147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63147" } ] } ] }, { "uniprot_ac": "Q6PCN7", "gene_name": "Hltf", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q6PCN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PCN7" } ] }, { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "Q6PCN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PCN7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q6PCN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PCN7" } ] } ] }, { "uniprot_ac": "Q7TPQ3", "gene_name": "Shprh", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q7TPQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TPQ3" } ] }, { "ec_number": "3.6.4.-", "activity": "", "evidence": [ { "id": "Q7TPQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TPQ3" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q7TPQ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TPQ3" } ] } ] }, { "uniprot_ac": "Q9QXK2", "gene_name": "Rad18", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q9QXK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q9QXK2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXK2" } ] } ] }, { "uniprot_ac": "Q9WVF7", "gene_name": "Pole", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9WVF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVF7" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9WVF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVF7" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "Q9WVF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVF7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }