{ "uniprot_canonical_ac": "Q9QWV4-1", "uniprot_ac": "Q9QWV4", "uniprot_id": "MLF1_MOUSE", "mass": { "chemical_mass": 30432.0, "monoisotopic_mass": 30432.0 }, "refseq": { "ac": "NP_034931", "name": "myeloid leukemia factor 1 isoform b", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034931" }, "gene_names": [ { "name": "Mlf1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9QWV4", "id": "Q9QWV4" }, { "name": "HLS7", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034632", "id": "NP_001034632" }, { "name": "Hls7", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9QWV4", "id": "Q9QWV4" }, { "name": "Mlf1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034632", "id": "NP_001034632" } ], "protein_names": [ { "name": "Myeloid leukemia factor 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9QWV4" }, { "name": "Hematopoietic lineage switch 7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QWV4" }, { "name": "Myelodysplasia-myeloid leukemia factor 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QWV4" }, { "name": "hematopoietic lineage switch 7; myelodysplasia-myeloid leukemia factor 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034931", "id": "NP_034931" }, { "name": "myeloid leukemia factor 1 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034632", "id": "NP_001034632" }, { "name": "myeloid leukemia factor 1 isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034931", "id": "NP_034931" } ], "function": [ { "annotation": "Ectopically expressed MLF1 could be responsible for the pathological apoptosis in early myelodysplastic syndrome (MDS) patients.", "evidence": [ { "database": "RefSeq", "id": "NP_034931", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034931" }, { "database": "PubMed", "id": "26563351", "url": "https://glygen.org/publication/PubMed/26563351" }, { "database": "RefSeq", "id": "NP_001034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034632" } ] }, { "annotation": "Involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. Interferes with erythropoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. Suppresses COP1 activity via CSN3 which activates p53 and induces cell cycle arrest. Binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4#function" }, { "database": "PubMed", "id": "10523300", "url": "https://glygen.org/publication/PubMed/10523300" }, { "database": "PubMed", "id": "15122318", "url": "https://glygen.org/publication/PubMed/15122318" } ] }, { "annotation": "The data indicate that MLF1 serves as a proapoptotic antagonist that interacts with the HAX1/HtrA2-OMI/PARL (HOP) mitochondrial complex to modulate cell survival.", "evidence": [ { "database": "RefSeq", "id": "NP_034931", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034931" }, { "database": "PubMed", "id": "28137643", "url": "https://glygen.org/publication/PubMed/28137643" }, { "database": "RefSeq", "id": "NP_001034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034632" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 149, "end_pos": 149, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on binding to YWHAZ.", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" }, { "database": "PubMed", "id": "17008314", "url": "https://glygen.org/publication/PubMed/17008314" } ] }, { "start_pos": 34, "end_pos": 34, "sequence_org": "S", "sequence_mut": "A", "comment": "70% reduction in binding to YWHAZ and increased nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" }, { "database": "PubMed", "id": "17008314", "url": "https://glygen.org/publication/PubMed/17008314" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mlf1", "url": "https://www.uniprot.org/uniprot/Q9QWV4", "locus": { "chromosome": "3", "start_pos": 67307336, "end_pos": 67281430, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000048416", "url": "https://www.ensembl.org/id/ENSMUSG00000048416" } ] } } ], "crossref": [ { "id": "ENSMUSG00000048416", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000048416", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "17349", "url": "https://www.ncbi.nlm.nih.gov/gene/17349", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9QWV4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9QWV4*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR019376", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019376", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:17349", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17349", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1341819", "url": "http://www.informatics.jax.org/marker/MGI:1341819", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "FINMNET", "url": "https://omabrowser.org/oma/group/FINMNET/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3678235at2759", "url": "http://www.orthodb.org/?query=3678235at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13105", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13105", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13105:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13105:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF10248", "url": "http://pfam.xfam.org/family/PF10248", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9QWV4", "url": "http://purl.obolibrary.org/obo/PR_Q9QWV4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_034931", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034931", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0A6YVP7", "url": "https://www.uniprot.org/uniprot/A0A0A6YVP7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0A6YVP7-1", "url": "https://www.uniprot.org/uniprot/A0A0A6YVP7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8JZS2", "url": "https://www.uniprot.org/uniprot/Q8JZS2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8JZS2-1", "url": "https://www.uniprot.org/uniprot/Q8JZS2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QWV4-1", "url": "https://www.uniprot.org/uniprot/Q9QWV4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSISDGRGRTHNRRERDDGEDSLTHADVNPFQTMDRMMANMRSGIQELQRNFGQLSMDPNGHSFCSSSVMTYSKVGDEPPKVFQASTQTRRAPGGVKETRKAMRDSDSGLERMAVGHHIHDRGHVIRKSKNNKTGDEEVNQEFINMNESDAHAFDDEWQNEVLKYKSIGRSGNTGMRSVGHEHPGSRELKRREKIHRNSAIESGRRSNVFVDKLNVKGSPVKITKK", "length": 267, "header": "sp|Q9QWV4-1|MLF1_MOUSE Isoform 1 of Myeloid leukemia factor 1 OS=Mus musculus OX=10090 GN=Mlf1 PE=1 SV=1 CANONICAL=Q9QWV4-1" }, "isoforms": [ { "isoform_ac": "A0A0A6YVP7-1", "url": "", "sequence": { "sequence": "MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSISDGRGRTHNRRERDDGEDSLTKTYLHL", "length": 71, "header": "tr|A0A0A6YVP7-1|A0A0A6YVP7_MOUSE Computationally mapped isoform of Myeloid leukemia factor 1 OS=Mus musculus OX=10090 GN=Mlf1 PE=1 SV=1 CANONICAL=Q9QWV4-1" }, "locus": { "chromosome": "3", "start_pos": 67300190, "end_pos": 67281549, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000126628.7", "url": "https://www.ensembl.org/id/ENSMUST00000126628.7" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000141208.2", "url": "https://www.ensembl.org/id/ENSMUSP00000141208.2" } ] } }, { "isoform_ac": "Q8JZS2-1", "url": "", "sequence": { "sequence": "MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSISDGRGRTHNRRERDDGEDSLTATSFSLVPFGRFGGMHADVNPFQTMDRMMANMRSGIQELQRNFGQLSMDPNGHSFCSSSVMTYSKVGDEPPKVFQASTQTRRAPGGVKETRKAMRDSDSGLERMAVGHHIHDRGHVIRKSKNNKTGDEEVNQEFINMNESDAHAFDDEWQNEVLKYKSIGRSGNTGMRSVGHEHPGSRELKRREKIHRNSAIESGRRSNVFVDKLNVKGSPVKITKK", "length": 282, "header": "tr|Q8JZS2-1|Q8JZS2_MOUSE Computationally mapped isoform of Myeloid leukemia factor 1 OS=Mus musculus OX=10090 GN=Mlf1 PE=1 SV=1 CANONICAL=Q9QWV4-1" }, "locus": { "chromosome": "3", "start_pos": 67307137, "end_pos": 67281549, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000061322.10", "url": "https://www.ensembl.org/id/ENSMUST00000061322.10" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000058596.9", "url": "https://www.ensembl.org/id/ENSMUSP00000058596.9" } ] } }, { "isoform_ac": "Q9QWV4-1", "url": "", "sequence": { "sequence": "MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSISDGRGRTHNRRERDDGEDSLTHADVNPFQTMDRMMANMRSGIQELQRNFGQLSMDPNGHSFCSSSVMTYSKVGDEPPKVFQASTQTRRAPGGVKETRKAMRDSDSGLERMAVGHHIHDRGHVIRKSKNNKTGDEEVNQEFINMNESDAHAFDDEWQNEVLKYKSIGRSGNTGMRSVGHEHPGSRELKRREKIHRNSAIESGRRSNVFVDKLNVKGSPVKITKK", "length": 267, "header": "sp|Q9QWV4-1|MLF1_MOUSE Isoform 1 of Myeloid leukemia factor 1 OS=Mus musculus OX=10090 GN=Mlf1 PE=1 SV=1 CANONICAL=Q9QWV4-1" }, "locus": { "chromosome": "3", "start_pos": 67307137, "end_pos": 67281549, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000077916", "url": "https://www.ensembl.org/id/ENSMUST00000077916" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000077072", "url": "https://www.ensembl.org/id/ENSMUSP00000077072" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 32, "end_pos": 32, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "site_lbl": "Ser32" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "site_lbl": "Ser34" }, { "start_pos": 6, "end_pos": 6, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9QWV4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QWV4" } ], "site_lbl": "Ser6" }, { "start_pos": 8, "end_pos": 8, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "site_lbl": "Ser8" } ], "glycation": [], "keywords": [], "publication": [ { "title": "cDNA cloning, expression pattern, and chromosomal localization of Mlf1, murine homologue of a gene involved in myelodysplasia and acute myeloid leukemia.", "journal": "Am. J. Pathol.", "date": "1999", "authors": "Copeland N.G., Gilbert D.J., Jenkins N.A., Look A.T., Morris S.W., Naeve C.W., Witte D.P., Hitzler J.K.", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "reference": [ { "type": "PubMed", "id": "10393836", "url": "https://glygen.org/publication/PubMed/10393836" } ] }, { "title": "HLS7, a hemopoietic lineage switch gene homologous to the leukemia-inducing gene MLF1.", "journal": "EMBO J.", "date": "1999", "authors": "Williams JH, Daly LN, Ingley E, Beaumont JG, Tilbrook PA, Lalonde JP, Stillitano JP, Klinken SP", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "reference": [ { "type": "PubMed", "id": "10523300", "url": "https://glygen.org/publication/PubMed/10523300" } ] }, { "title": "MADM, a novel adaptor protein that mediates phosphorylation of the 14-3-3 binding site of myeloid leukemia factor 1.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Lim R, Winteringham LN, Williams JH, McCulloch RK, Ingley E, Tiao JY, Lalonde JP, Tsai S, Tilbrook PA, Sun Y, Wu X, Morris SW, Klinken SP", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "reference": [ { "type": "PubMed", "id": "12176995", "url": "https://glygen.org/publication/PubMed/12176995" } ] }, { "title": "Myeloid leukemia factor 1 inhibits erythropoietin-induced differentiation, cell cycle exit and p27Kip1 accumulation.", "journal": "Oncogene", "date": "2004", "authors": "Ingley E., Williams J.H., Klinken S.P., Winteringham L.N., Kobelke S.", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "reference": [ { "type": "PubMed", "id": "15122318", "url": "https://glygen.org/publication/PubMed/15122318" } ] }, { "title": "Myeloid leukemia factor 1 associates with a novel heterogeneous nuclear ribonucleoprotein U-like molecule.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Winteringham LN, Endersby R, Kobelke S, McCulloch RK, Williams JH, Stillitano J, Cornwall SM, Ingley E, Klinken SP", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "reference": [ { "type": "PubMed", "id": "17008314", "url": "https://glygen.org/publication/PubMed/17008314" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" }, { "database": "iPTMnet", "id": "Q9QWV4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QWV4" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Myeloid leukemia factor 1 interfered with Bcl-XL to promote apoptosis and its function was regulated by 14-3-3.", "journal": "Journal of physiology and biochemistry", "date": "2015", "authors": "Sun Y, Fu A, Xu W, Chao JR, Moshiach S, Morris SW", "evidence": [ { "database": "RefSeq", "id": "NP_001034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034632" }, { "database": "RefSeq", "id": "NP_034931", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034931" } ], "reference": [ { "type": "PubMed", "id": "26563351", "url": "https://glygen.org/publication/PubMed/26563351" } ] }, { "title": "Identification of FOXJ1 effectors during ciliogenesis in the foetal respiratory epithelium and embryonic left-right organiser of the mouse.", "journal": "Dev. Biol.", "date": "2017", "authors": "Beckers A., Mai M., Gossler A., Kracht M., Stauber M., Weidemann M., Alten L., Dittrich-Breiholz O., Lobschat K.", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "reference": [ { "type": "PubMed", "id": "27914912", "url": "https://glygen.org/publication/PubMed/27914912" } ] }, { "title": "MLF1 is a proapoptotic antagonist of HOP complex-mediated survival.", "journal": "Biochimica et biophysica acta. Molecular cell research", "date": "2017", "authors": "Sun Y, Chao JR, Xu W, Pourpak A, Boyd K, Moshiach S, Qi GY, Fu A, Shao HR, Pounds S, Morris SW", "evidence": [ { "database": "RefSeq", "id": "NP_001034632", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001034632" }, { "database": "RefSeq", "id": "NP_034931", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_034931" } ], "reference": [ { "type": "PubMed", "id": "28137643", "url": "https://glygen.org/publication/PubMed/28137643" } ] } ], "pathway": [ { "id": "mmu:17349", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:17349", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZCQ9-1", "protein_name": "Myeloid leukemia factor 1", "gene_name": "Mlf1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSISDGRGRTHNRRERDDGEDSLTATNFSLVPFGRFGGMHADVNPFQTMDRMMVNMRNSIQELQRNFGQLSMDPNGHSFCSSSVMTYSKVGDEPPKVFQAATQTRRAPGGVKETRKAIRDSDSGLERMAVGHHIHDRAHVIRKSKNNKTGDEEVDQEFINMNESDAHAFDDEWQNEVLKYKPIGRSGNTGMRNVDHEHLGSRELKRREKIHRNSTIESGRRANIFVDKLNVKGSPVKITKK", "length": 282 }, "evidence": [ { "id": "45238262", "url": "http://www.informatics.jax.org/homology/45238262", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P58340-1", "protein_name": "Myeloid leukemia factor 1", "gene_name": "MLF1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK", "length": 268 }, "evidence": [ { "id": "45238262", "url": "http://www.informatics.jax.org/homology/45238262", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "cilium", "id": "GO:0005929", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005929", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "motile cilium", "id": "GO:0031514", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031514", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "non-motile cilium", "id": "GO:0097730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097730", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "ciliary basal body", "id": "GO:0036064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036064", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "ciliary base", "id": "GO:0097546", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097546", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "myeloid progenitor cell differentiation", "id": "GO:0002318", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002318", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "regulation of signal transduction by p53 class mediator", "id": "GO:1901796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901796", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "cell cycle", "id": "GO:0007049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007049", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "regulation of cell cycle G1/S phase transition", "id": "GO:1902806", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902806", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" }, { "name": "protein domain specific binding", "id": "GO:0019904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019904", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 173, "end_pos": 175, "annotation": "n_glycosylation_sequon" }, { "start_pos": 188, "end_pos": 190, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation is required for binding to YWHAZ.", "evidence": [ { "database": "UniProtKB", "id": "Q9QWV4", "url": "https://www.uniprot.org/uniprot/Q9QWV4" }, { "database": "PubMed", "id": "12176995", "url": "https://glygen.org/publication/PubMed/12176995" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }