{ "uniprot_canonical_ac": "Q9QUM4-1", "uniprot_ac": "Q9QUM4", "uniprot_id": "SLAF1_MOUSE", "mass": { "chemical_mass": 38094.0, "monoisotopic_mass": 38094.0 }, "refseq": { "ac": "NP_038758", "name": "signaling lymphocytic activation molecule isoform 1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758" }, "gene_names": [ { "name": "Slamf1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9QUM4", "id": "Q9QUM4" }, { "name": "4933415F16; CD150; CDw150; ESTM51; IPO-3; Slam", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758", "id": "NP_038758" }, { "name": "Slamf1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758", "id": "NP_038758" }, { "name": "Slam", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9QUM4", "id": "Q9QUM4" } ], "protein_names": [ { "name": "Signaling lymphocytic activation molecule", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9QUM4" }, { "name": "SLAM family member 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9QUM4" }, { "name": "signaling lymphocyte activation molecule; SLAM family member 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758", "id": "NP_038758" }, { "name": "signaling lymphocytic activation molecule isoform 1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758", "id": "NP_038758" } ], "function": [ { "annotation": "(Microbial infection) Involved in innate immune response against Gram-negative bacteria in macrophages; probably recognizes OmpC and/or OmpF on the bacterial surface, regulates phagosome maturation and recruitment of the PI3K complex II (PI3KC3-C2) leading to accumulated of PdtIns(3)P and NOX2 activity in the phagosomes (PubMed:20818396, PubMed:22493499).", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4#function" }, { "database": "PubMed", "id": "20818396", "url": "https://glygen.org/publication/PubMed/20818396" }, { "database": "PubMed", "id": "22493499", "url": "https://glygen.org/publication/PubMed/22493499" } ] }, { "annotation": "Critical Role for SLAM/SAP Signaling in the Thymic Developmental Programming of IL-17- and IFN-gamma-Producing gammadelta T Cells.", "evidence": [ { "database": "RefSeq", "id": "NP_038758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758" }, { "database": "PubMed", "id": "32024701", "url": "https://glygen.org/publication/PubMed/32024701" } ] }, { "annotation": "Identification of SLAMF1 as an immune-related key gene associated with rheumatoid arthritis and verified in mice collagen-induced arthritis model. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_038758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758" }, { "database": "PubMed", "id": "36110846", "url": "https://glygen.org/publication/PubMed/36110846" } ] }, { "annotation": "Interaction of Signaling Lymphocytic Activation Molecule Family 1 (SLAMF1) receptor with Trypanosoma cruzi is strain-dependent and affects NADPH oxidase expression and activity. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_038758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758" }, { "database": "PubMed", "id": "32925918", "url": "https://glygen.org/publication/PubMed/32925918" } ] }, { "annotation": "SLAMF1 Is Dispensable for Vaccine-Induced T Cell Development but Required for Resistance to Fungal Infection.", "evidence": [ { "database": "RefSeq", "id": "NP_038758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758" }, { "database": "PubMed", "id": "35217584", "url": "https://glygen.org/publication/PubMed/35217584" } ] }, { "annotation": "Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. SLAMF1-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAMF1 signaling seem to exist: one depending on SH2D1A (and perhaps SH2D1B) and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates. Initially it has been proposed that association with SH2D1A prevents binding to inhibitory effectors including INPP5D/SHIP1 and PTPN11/SHP-2 (By similarity). However, signaling is also regulated by SH2D1A which can simultaneously interact with and recruit FYN which subsequently phosphorylates and activates SLAMF1 (By similarity). Mediates IL-2-independent proliferation of activated T-cells during immune responses and induces IFN-gamma production (PubMed:9126961, PubMed:12351401). Downstreaming signaling involves INPP5D, DOK1 and DOK2 leading to inhibited IFN-gamma production in T-cells, and PRKCQ, BCL10 and NFKB1 leading to increased T-cell activation and Th2 cytokine production (PubMed:11477403, PubMed:16847311, PubMed:15539155). Promotes T-cell receptor-induced IL-4 secretion by CD4(+) cells (PubMed:15123745). Inhibits antigen receptor-mediated production of IFN-gamma, but not IL-2, in CD4(-)/CD8(-) T-cells (PubMed:11477403). Required for IL-4 production by germinal centers T follicular helper (T(Fh))cells (PubMed:20525889). May inhibit CD40-induced signal transduction in monocyte-derived dendritic cells (By similarity). May play a role in allergic responses and may regulate allergen-induced Th2 cytokine and Th1 cytokine secretion (PubMed:16528012). In conjunction with SLAMF6 controls the transition between positive selection and the subsequent expansion and differentiation of the thymocytic natural killer T (NKT) cell lineage (PubMed:18031695). Involved in the peripheral differentiation of indifferent natural killer T (iNKT) cells toward a regulatory NKT2 type (PubMed:18606638). In macrophages involved in down-regulation of IL-12, TNF-alpha and nitric oxide in response to lipopolysaccharide (LPS) (PubMed:15123745). In B-cells activates the ERK signaling pathway independently of SH2D1A but implicating both, SYK and INPP5D, and activates Akt signaling dependent on SYK and SH2D1A (PubMed:15315965). In conjunction with CD84/SLAMF5 and SLAMF6 may be a negative regulator of the humoral immune response (PubMed:25926831).", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4#function" }, { "database": "UniProtKB", "id": "Q13291", "url": "https://www.uniprot.org/uniprot/Q13291#function" }, { "database": "PubMed", "id": "15315965", "url": "https://glygen.org/publication/PubMed/15315965" }, { "database": "PubMed", "id": "9126961", "url": "https://glygen.org/publication/PubMed/9126961" }, { "database": "PubMed", "id": "15123745", "url": "https://glygen.org/publication/PubMed/15123745" }, { "database": "PubMed", "id": "25926831", "url": "https://glygen.org/publication/PubMed/25926831" }, { "database": "PubMed", "id": "15539155", "url": "https://glygen.org/publication/PubMed/15539155" }, { "database": "PubMed", "id": "18606638", "url": "https://glygen.org/publication/PubMed/18606638" }, { "database": "PubMed", "id": "18031695", "url": "https://glygen.org/publication/PubMed/18031695" }, { "database": "PubMed", "id": "11477403", "url": "https://glygen.org/publication/PubMed/11477403" }, { "database": "PubMed", "id": "16847311", "url": "https://glygen.org/publication/PubMed/16847311" }, { "database": "PubMed", "id": "16528012", "url": "https://glygen.org/publication/PubMed/16528012" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3388518877", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388518877" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 126, "end_pos": 126, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NVS->YVS).", "chr_id": "1", "chr_pos": "171602650", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N126", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3388513994", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388513994" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 211, "end_pos": 211, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->ICT).", "chr_id": "1", "chr_pos": "171604863", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N211", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3388511852", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388511852" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 331, "end_pos": 331, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NST).", "chr_id": "1", "chr_pos": "171627150", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P331", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 288, "end_pos": 288, "sequence_org": "Y", "sequence_mut": "A", "comment": "Greatly reduces SLAMF1:SH2D1A-mediated intracellular tyrosine phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" }, { "database": "PubMed", "id": "11477403", "url": "https://glygen.org/publication/PubMed/11477403" } ] }, { "start_pos": 315, "end_pos": 315, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes SLAMF1:SH2D1A-mediated intracellular tyrosine phosphorylation, no effect on interaction with SH2D1A; when associated with A-335.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" }, { "database": "PubMed", "id": "11477403", "url": "https://glygen.org/publication/PubMed/11477403" } ] }, { "start_pos": 335, "end_pos": 335, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes SLAMF1:SH2D1A-mediated intracellular tyrosine phosphorylation, no effect on interaction with SH2D1A; when associated with A-315.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" }, { "database": "PubMed", "id": "11477403", "url": "https://glygen.org/publication/PubMed/11477403" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Slamf1", "url": "https://www.uniprot.org/uniprot/Q9QUM4", "locus": { "chromosome": "1", "start_pos": 171628752, "end_pos": 171594695, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000015316", "url": "https://www.ensembl.org/id/ENSMUSG00000015316" } ] } } ], "crossref": [ { "id": "ENSMUSG00000015316", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000015316", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "27218", "url": "https://www.ncbi.nlm.nih.gov/gene/27218", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0007646", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0007646", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0007647", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0007647", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "Q9QUM4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9QUM4*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010407", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010407", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:27218", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:27218", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1351314", "url": "http://www.informatics.jax.org/marker/MGI:1351314", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9QUM4", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9QUM4", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DHVAYNW", "url": "https://omabrowser.org/oma/group/DHVAYNW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5322276at2759", "url": "http://www.orthodb.org/?query=5322276at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12080", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12080", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12080:SF49", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12080:SF49", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06214", "url": "http://pfam.xfam.org/family/PF06214", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9QUM4", "url": "http://purl.obolibrary.org/obo/PR_Q9QUM4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_038758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QUM4-1", "url": "https://www.uniprot.org/uniprot/Q9QUM4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9QUM4-2", "url": "https://www.uniprot.org/uniprot/Q9QUM4-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDPKGSLSWRILLFLSLAFELSYGTGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSPWMQYTLVPLGVVIIFILVFTAIIMMKRQGKSNHCQPPVEEKSLTIYAQVQKSGPQEKKLHDALTDQDPCTTIYVAATEPAPESVQEPNPTTVYASVTLPES", "length": 343, "header": "sp|Q9QUM4-1|SLAF1_MOUSE Isoform 1 of Signaling lymphocytic activation molecule OS=Mus musculus OX=10090 GN=Slamf1 PE=1 SV=1 CANONICAL=Q9QUM4-1" }, "isoforms": [ { "isoform_ac": "Q9QUM4-1", "url": "", "sequence": { "sequence": "MDPKGSLSWRILLFLSLAFELSYGTGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSPWMQYTLVPLGVVIIFILVFTAIIMMKRQGKSNHCQPPVEEKSLTIYAQVQKSGPQEKKLHDALTDQDPCTTIYVAATEPAPESVQEPNPTTVYASVTLPES", "length": 343, "header": "sp|Q9QUM4-1|SLAF1_MOUSE Isoform 1 of Signaling lymphocytic activation molecule OS=Mus musculus OX=10090 GN=Slamf1 PE=1 SV=1 CANONICAL=Q9QUM4-1" }, "locus": { "chromosome": "1", "start_pos": 171627188, "end_pos": 171594795, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000015460", "url": "https://www.ensembl.org/id/ENSMUST00000015460" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000015460", "url": "https://www.ensembl.org/id/ENSMUSP00000015460" } ] } }, { "isoform_ac": "Q9QUM4-2", "url": "", "sequence": { "sequence": "MDPKGSLSWRILLFLSLAFELSYGTGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSPWMQYTLVPLGVVIIFILVFTAIIMMKRQGKSNHCQPPVEEKSLTIYAQVQKSGVRSMPHLAGVSVIFRTGFLIAALHTTMVLQGLLE", "length": 329, "header": "sp|Q9QUM4-2|SLAF1_MOUSE Isoform 2 of Signaling lymphocytic activation molecule OS=Mus musculus OX=10090 GN=Slamf1 PE=1 SV=1 CANONICAL=Q9QUM4-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "Q9QUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUM4#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 126, "start_aa": "Asn", "end_pos": 126, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn126", "evidence": [ { "id": "Q9QUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUM4#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 151, "start_aa": "Asn", "end_pos": 151, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn151", "evidence": [ { "id": "Q9QUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUM4#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 158, "start_aa": "Asn", "end_pos": 158, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn158", "evidence": [ { "id": "Q9QUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUM4#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 192, "start_aa": "Asn", "end_pos": 192, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn192", "evidence": [ { "id": "Q9QUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUM4#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 211, "start_aa": "Asn", "end_pos": 211, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn211", "evidence": [ { "id": "Q9QUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUM4#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 226, "start_aa": "Asn", "end_pos": 226, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn226", "evidence": [ { "id": "Q9QUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUM4#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 54, "start_aa": "Asn", "end_pos": 54, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn54", "evidence": [ { "id": "Q9QUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUM4#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 58, "start_aa": "Asn", "end_pos": 58, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn58", "evidence": [ { "id": "Q9QUM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUM4#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q9QUM4", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9QUM4" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] } ], "phosphorylation": [ { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" }, { "database": "IntAct", "id": "Q9QUM4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9QUM4*" }, { "database": "iPTMnet", "id": "Q9QUM4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QUM4" }, { "database": "PubMed", "id": "11477403", "url": "https://glygen.org/publication/PubMed/11477403" }, { "database": "PubMed", "id": "11689425", "url": "https://glygen.org/publication/PubMed/11689425" }, { "database": "phospho.ELM", "id": "Q9QUM4", "url": "http://phospho.elm.eu.org/byAccession/Q9QUM4.html" } ], "site_lbl": "Tyr288" }, { "start_pos": 315, "end_pos": 315, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" }, { "database": "IntAct", "id": "Q9QUM4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9QUM4*" }, { "database": "iPTMnet", "id": "Q9QUM4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QUM4" }, { "database": "PubMed", "id": "11477403", "url": "https://glygen.org/publication/PubMed/11477403" }, { "database": "phospho.ELM", "id": "Q9QUM4", "url": "http://phospho.elm.eu.org/byAccession/Q9QUM4.html" } ], "site_lbl": "Tyr315" }, { "start_pos": 335, "end_pos": 335, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FYN", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" }, { "database": "IntAct", "id": "Q9QUM4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9QUM4*" }, { "database": "iPTMnet", "id": "Q9QUM4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QUM4" }, { "database": "PubMed", "id": "11477403", "url": "https://glygen.org/publication/PubMed/11477403" }, { "database": "phospho.ELM", "id": "Q9QUM4", "url": "http://phospho.elm.eu.org/byAccession/Q9QUM4.html" } ], "site_lbl": "Tyr335" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Molecular and functional characterization of mouse signaling lymphocytic activation molecule (SLAM): differential expression and responsiveness in Th1 and Th2 cells.", "journal": "J. Immunol.", "date": "1999", "authors": "Robinson D., Lanier L.L., Aversa G., Abrams J., Nichols K.E., Tangye S.G., Zurawski S., O'Garra A., de Vries J.E., Churakova T., Cocks B.G., Zonin F., Castro A.G., Hauser T.M.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "10570270", "url": "https://glygen.org/publication/PubMed/10570270" } ] }, { "title": "Regulation of SLAM-mediated signal transduction by SAP, the X-linked lymphoproliferative gene product.", "journal": "Nat. Immunol.", "date": "2001", "authors": "Latour S, Gish G, Helgason CD, Humphries RK, Pawson T, Veillette A", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" }, { "database": "iPTMnet", "id": "Q9QUM4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "11477403", "url": "https://glygen.org/publication/PubMed/11477403" } ] }, { "title": "Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells.", "journal": "EMBO J.", "date": "2001", "authors": "Morra M, Lu J, Poy F, Martin M, Sayos J, Calpe S, Gullo C, Howie D, Rietdijk S, Thompson A, Coyle AJ, Denny C, Yaffe MB, Engel P, Eck MJ, Terhorst C", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" }, { "database": "iPTMnet", "id": "Q9QUM4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "11689425", "url": "https://glygen.org/publication/PubMed/11689425" } ] }, { "title": "The role of SAP in murine CD150 (SLAM)-mediated T-cell proliferation and interferon gamma production.", "journal": "Blood", "date": "2002", "authors": "Okamoto S., Wang N., Manning S., Terhorst C., Coyle A.J., Howie D., Kuchroo V., Gullo C., Rietdijk S., Clarke K., Bruggeman J.P., Greenfield E.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "12351401", "url": "https://glygen.org/publication/PubMed/12351401" } ] }, { "title": "The cell surface receptor SLAM controls T cell and macrophage functions.", "journal": "J. Exp. Med.", "date": "2004", "authors": "Okamoto S., Wang N., Terhorst C., Sharpe A.H., Feske S., Howie D., Gullo C., Clarke K., Faubion W., Satoskar A., Sosa M.R.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "15123745", "url": "https://glygen.org/publication/PubMed/15123745" } ] }, { "title": "The adaptor protein SH2D1A regulates signaling through CD150 (SLAM) in B cells.", "journal": "Blood", "date": "2004", "authors": "Mikhalap SV, Shlapatska LM, Yurchenko OV, Yurchenko MY, Berdova GG, Nichols KE, Clark EA, Sidorenko SP", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "15315965", "url": "https://glygen.org/publication/PubMed/15315965" } ] }, { "title": "SAP regulates T(H)2 differentiation and PKC-theta-mediated activation of NF-kappaB1.", "journal": "Immunity", "date": "2004", "authors": "Antonellis A., Cannons J.L., Schwartzberg P.L., Nichols K.E., Gardner K., Koretzky G.A., Hill B., Dombroski D., Mijares L.A., Yu L.J.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "15539155", "url": "https://glygen.org/publication/PubMed/15539155" } ] }, { "title": "The costimulatory molecule SLAM is critical for pulmonary allergic responses.", "journal": "Am. J. Respir. Cell Mol. Biol.", "date": "2006", "authors": "Wang N., Terhorst C., Finn P.W., Campo M., Fleming C., Ting L.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "16528012", "url": "https://glygen.org/publication/PubMed/16528012" } ] }, { "title": "Association between SAP and FynT: Inducible SH3 domain-mediated interaction controlled by engagement of the SLAM receptor.", "journal": "Mol. Cell. Biol.", "date": "2006", "authors": "Chen R., Shi X., Latour S., Veillette A.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "16847311", "url": "https://glygen.org/publication/PubMed/16847311" } ] }, { "title": "Homotypic interactions mediated by Slamf1 and Slamf6 receptors control NKT cell lineage development.", "journal": "Immunity", "date": "2007", "authors": "Griewank K, Borowski C, Rietdijk S, Wang N, Julien A, Wei DG, Mamchak AA, Terhorst C, Bendelac A", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "18031695", "url": "https://glygen.org/publication/PubMed/18031695" } ] }, { "title": "Impaired SLAM-SLAM homotypic interaction between invariant NKT cells and dendritic cells affects differentiation of IL-4/IL-10-secreting NKT2 cells in nonobese diabetic mice.", "journal": "J. Immunol.", "date": "2008", "authors": "Nichols K.E., Coccia M., Falcone M., Ronchi F., Baev D.V., Caielli S., Facciotti F.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "18606638", "url": "https://glygen.org/publication/PubMed/18606638" } ] }, { "title": "Germinal center T follicular helper cell IL-4 production is dependent on signaling lymphocytic activation molecule receptor (CD150).", "journal": "J. Immunol.", "date": "2010", "authors": "Kageyama R., Hansen K., Crotty S., Yusuf I., Barnett B., Ditoro D., Johnston R.J., Monticelli L.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "20525889", "url": "https://glygen.org/publication/PubMed/20525889" } ] }, { "title": "SLAM is a microbial sensor that regulates bacterial phagosome functions in macrophages.", "journal": "Nat. Immunol.", "date": "2010", "authors": "Wang G., Wang N., Ma C., Reinecker H.C., Regueiro J.R., Terhorst C., Romero X., Boes M., Liao G., Keszei M., Berger S.B., Compeer E., Faubion W.A., Rameh L.", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "20818396", "url": "https://glygen.org/publication/PubMed/20818396" } ] }, { "title": "Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex.", "journal": "J. Biol. Chem.", "date": "2012", "authors": "Ma C, Wang N, Detre C, Wang G, O'Keeffe M, Terhorst C", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "22493499", "url": "https://glygen.org/publication/PubMed/22493499" } ] }, { "title": "Negative regulation of humoral immunity due to interplay between the SLAMF1, SLAMF5, and SLAMF6 receptors.", "journal": "Front. Immunol.", "date": "2015", "authors": "Wang N, Halibozek PJ, Yigit B, Zhao H, O'Keeffe MS, Sage P, Sharpe A, Terhorst C", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "25926831", "url": "https://glygen.org/publication/PubMed/25926831" } ] }, { "title": "O-GlcNAcylation is required for B cell homeostasis and antibody responses.", "journal": "Nature communications", "date": "2017", "authors": "Wu JL, Chiang MF, Hsu PH, Tsai DY, Hung KH, Wang YH, Angata T, Lin KI", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9QUM4", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "29187734", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "title": "Critical Role for SLAM/SAP Signaling in the Thymic Developmental Programming of IL-17- and IFN-gamma-Producing gammadelta T Cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2020", "authors": "Dienz O, DeVault VL, Musial SC, Mistri SK, Mei L, Baraev A, Dragon JA, Krementsov D, Veillette A, Boyson JE", "evidence": [ { "database": "RefSeq", "id": "NP_038758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758" } ], "reference": [ { "type": "PubMed", "id": "32024701", "url": "https://glygen.org/publication/PubMed/32024701" } ] }, { "title": "Interaction of Signaling Lymphocytic Activation Molecule Family 1 (SLAMF1) receptor with Trypanosoma cruzi is strain-dependent and affects NADPH oxidase expression and activity.", "journal": "PLoS neglected tropical diseases", "date": "2020", "authors": "Poveda C, Herreros-Cabello A, Callejas-Hernandez F, Osuna-Perez J, Maza MC, Chillon-Marinas C, Calderon J, Stamatakis K, Fresno M, Girones N", "evidence": [ { "database": "RefSeq", "id": "NP_038758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758" } ], "reference": [ { "type": "PubMed", "id": "32925918", "url": "https://glygen.org/publication/PubMed/32925918" } ] }, { "title": "SLAMF1 Is Dispensable for Vaccine-Induced T Cell Development but Required for Resistance to Fungal Infection.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2022", "authors": "Kohn EM, Dos Santos Dias L, Dobson HE, He X, Wang H, Klein BS, Wuthrich M", "evidence": [ { "database": "RefSeq", "id": "NP_038758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758" } ], "reference": [ { "type": "PubMed", "id": "35217584", "url": "https://glygen.org/publication/PubMed/35217584" } ] }, { "title": "Identification of SLAMF1 as an immune-related key gene associated with rheumatoid arthritis and verified in mice collagen-induced arthritis model.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Li A, Zhang Z, Ru X, Yi Y, Li X, Qian J, Wang J, Yang X, Yao Y", "evidence": [ { "database": "RefSeq", "id": "NP_038758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_038758" } ], "reference": [ { "type": "PubMed", "id": "36110846", "url": "https://glygen.org/publication/PubMed/36110846" } ] }, { "title": "Engagement of the signaling lymphocytic activation molecule (SLAM) on activated T cells results in IL-2-independent, cyclosporin A-sensitive T cell proliferation and IFN-gamma production.", "journal": "J. Immunol.", "date": "1997", "authors": "Aversa G, Chang CC, Carballido JM, Cocks BG, de Vries JE", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "9126961", "url": "https://glygen.org/publication/PubMed/9126961" } ] }, { "title": "The X-linked lymphoproliferative-disease gene product SAP regulates signals induced through the co-receptor SLAM.", "journal": "Nature", "date": "1998", "authors": "Sayos J, Wu C, Morra M, Wang N, Zhang X, Allen D, van Schaik S, Notarangelo L, Geha R, Roncarolo MG, Oettgen H, De Vries JE, Aversa G, Terhorst C", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "reference": [ { "type": "PubMed", "id": "9774102", "url": "https://glygen.org/publication/PubMed/9774102" } ] } ], "pathway": [ { "id": "mmu:27218", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:27218", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZAD7-1", "protein_name": "Signaling lymphocytic activation molecule family member 1", "gene_name": "Slamf1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDPNRSLSLRILLFLSLAVELSYGTGTGMMDCPVILQELGRDTWLALTNEHQINKSANKSIRILVTMARSPGSKTNKKIVSFDLSKGGYPDHLEDGYQFQSKNLSLKILGNRRESEGLYFVTVEENVSVHQSCTQLKLYEQVSTPEIKVLNKTQEENGTCHLLLACTVKRGDNVSYSWGDEAGTRLPSQANRSHLLHLILSNQHQDSIYNCTASNPVSSRSRTFNLWQQCRPESYSESSLWLPYIAAPLGVIIFVILVSIATVLVKRYWAPSGKPNHCQPPVEEKSLTIYAQVQKSGPLEKELHDALTDQDPCTTIYVAATEPVPESVQEPNPTTVYASVTLPES", "length": 345 }, "evidence": [ { "id": "45243658", "url": "http://www.informatics.jax.org/homology/45243658", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q13291-1", "protein_name": "Signaling lymphocytic activation molecule", "gene_name": "SLAMF1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES", "length": 335 }, "evidence": [ { "id": "45243658", "url": "http://www.informatics.jax.org/homology/45243658", "database": "MGI" }, { "id": "Q9QUM4", "url": "https://omabrowser.org/oma/group/Q9QUM4/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 23, "go_terms": [ { "name": "natural killer cell differentiation", "id": "GO:0001779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001779", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "negative regulation of T cell cytokine production", "id": "GO:0002725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002725", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "positive regulation of JNK cascade", "id": "GO:0046330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046330", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "phagocytosis", "id": "GO:0006909", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006909", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "negative regulation of type II interferon production", "id": "GO:0032689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032689", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "negative regulation of interleukin-6 production", "id": "GO:0032715", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032715", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "negative regulation of tumor necrosis factor production", "id": "GO:0032720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032720", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "regulation of catalytic activity", "id": "GO:0050790", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050790", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "positive regulation of type II interferon production", "id": "GO:0032729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032729", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "negative regulation of interleukin-12 production", "id": "GO:0032695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032695", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "regulation of vesicle fusion", "id": "GO:0031338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031338", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "myeloid dendritic cell activation involved in immune response", "id": "GO:0002277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002277", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "positive regulation of activated T cell proliferation", "id": "GO:0042104", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042104", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "negative regulation of CD40 signaling pathway", "id": "GO:2000349", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000349", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "positive regulation of dendritic cell chemotaxis", "id": "GO:2000510", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000510", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "positive regulation of T-helper 1 cell cytokine production", "id": "GO:2000556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000556", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "positive regulation of macrophage chemotaxis", "id": "GO:0010759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010759", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "leukocyte chemotaxis involved in inflammatory response", "id": "GO:0002232", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002232", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "natural killer cell proliferation", "id": "GO:0001787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001787", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "phagocytic vesicle", "id": "GO:0045335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045335", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "SH2 domain binding", "id": "GO:0042169", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042169", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" }, { "name": "signaling receptor activity", "id": "GO:0038023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038023", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 103, "end_pos": 105, "annotation": "n_glycosylation_sequon" }, { "start_pos": 126, "end_pos": 128, "annotation": "n_glycosylation_sequon" }, { "start_pos": 151, "end_pos": 153, "annotation": "n_glycosylation_sequon" }, { "start_pos": 158, "end_pos": 160, "annotation": "n_glycosylation_sequon" }, { "start_pos": 192, "end_pos": 194, "annotation": "n_glycosylation_sequon" }, { "start_pos": 211, "end_pos": 213, "annotation": "n_glycosylation_sequon" }, { "start_pos": 226, "end_pos": 228, "annotation": "n_glycosylation_sequon" }, { "start_pos": 54, "end_pos": 56, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated on tyrosine residues by FYN (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9QUM4", "url": "https://www.uniprot.org/uniprot/Q9QUM4" }, { "database": "PubMed", "id": "Q13291", "url": "https://glygen.org/publication/PubMed/Q13291" }, { "database": "PubMed", "id": "11477403", "url": "https://glygen.org/publication/PubMed/11477403" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 9 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 9 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 22 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }