{ "uniprot_canonical_ac": "Q9NY61-1", "uniprot_ac": "Q9NY61", "uniprot_id": "AATF_HUMAN", "mass": { "chemical_mass": 63133.0, "monoisotopic_mass": 63133.0 }, "refseq": { "ac": "NP_036270", "name": "protein AATF isoform 1", "summary": "The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036270" }, "gene_names": [ { "name": "AATF", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9NY61", "id": "Q9NY61" }, { "name": "CHE1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9NY61", "id": "Q9NY61" }, { "name": "DED", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9NY61", "id": "Q9NY61" }, { "name": "HSPC277", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9NY61", "id": "Q9NY61" } ], "protein_names": [ { "name": "Protein AATF", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9NY61" }, { "name": "Apoptosis-antagonizing transcription factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NY61" }, { "name": "Rb-binding protein Che-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NY61" }, { "name": "protein AATF isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036270", "id": "NP_036270" }, { "name": "protein AATF; rb-binding protein Che-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036270", "id": "NP_036270" } ], "function": [ { "annotation": "CK2-mediated phosphorylation of Che-1/AATF is required for its pro-proliferative activity. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_036270", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036270" }, { "database": "PubMed", "id": "34266450", "url": "https://glygen.org/publication/PubMed/34266450" } ] }, { "annotation": "Che-1/AATF binds to RNA polymerase I machinery and sustains ribosomal RNA gene transcription.", "evidence": [ { "database": "RefSeq", "id": "NP_036270", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036270" }, { "database": "PubMed", "id": "32421830", "url": "https://glygen.org/publication/PubMed/32421830" } ] }, { "annotation": "Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome (PubMed:34516797). May function as a general inhibitor of the histone deacetylase HDAC1. Binding to the pocket region of RB1 may displace HDAC1 from RB1/E2F complexes, leading to activation of E2F target genes and cell cycle progression. Conversely, displacement of HDAC1 from SP1 bound to the CDKN1A promoter leads to increased expression of this CDK inhibitor and blocks cell cycle progression. Also antagonizes PAWR mediated induction of aberrant amyloid peptide production in Alzheimer disease (presenile and senile dementia), although the molecular basis for this phenomenon has not been described to date.", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61#function" }, { "database": "PubMed", "id": "15207272", "url": "https://glygen.org/publication/PubMed/15207272" }, { "database": "PubMed", "id": "12847090", "url": "https://glygen.org/publication/PubMed/12847090" }, { "database": "PubMed", "id": "14627703", "url": "https://glygen.org/publication/PubMed/14627703" }, { "database": "PubMed", "id": "12450794", "url": "https://glygen.org/publication/PubMed/12450794" }, { "database": "PubMed", "id": "34516797", "url": "https://glygen.org/publication/PubMed/34516797" } ] }, { "annotation": "The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_036270", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036270" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1357736040", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1357736040" }, { "id": "rs1357736040", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1357736040" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 153, "end_pos": 153, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SIS->NIS); o-glyco-site-loss (S->N).", "chr_id": "17", "chr_pos": "36986731", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S153", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs764440640", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764440640" }, { "id": "rs764440640", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764440640" }, { "id": "rs764440640", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs764440640" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 146, "end_pos": 146, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "17", "chr_pos": "36953038", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T146", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1225842661", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1225842661" }, { "id": "rs1225842661", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1225842661#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 155, "end_pos": 155, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "17", "chr_pos": "36953067", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S155", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1458279885", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1458279885" }, { "id": "rs1458279885", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1458279885#frequency_tab" }, { "id": "rs1458279885", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1458279885" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 358, "end_pos": 358, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DFT->NFT).", "chr_id": "17", "chr_pos": "36988643", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D358", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs140200159", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140200159" }, { "id": "rs140200159", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140200159" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 372, "end_pos": 372, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DKT->NKT).", "chr_id": "17", "chr_pos": "36988685", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D372", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs141756894", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141756894" }, { "id": "rs141756894", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs141756894" }, { "id": "rs141756894", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs141756894" }, { "id": "rs141756894", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs141756894#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 476, "end_pos": 476, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TSS->NSS).", "chr_id": "17", "chr_pos": "37019033", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T476", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs773538745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773538745" }, { "id": "rs773538745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773538745" }, { "id": "rs773538745", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs773538745#frequency_tab" }, { "id": "rs773538745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs773538745" }, { "id": "rs114527666", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114527666" }, { "id": "rs114527666", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs114527666" }, { "id": "rs114527666", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs114527666" }, { "id": "rs114527666", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs114527666#frequency_tab" }, { "id": "rs114527666", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs114527666" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 531, "end_pos": 531, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DHT->NHT).", "chr_id": "17", "chr_pos": "37031657", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D531", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "90.24", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000275700", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275700" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "85.34", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000275700", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275700" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "92.34", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000275700", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275700" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "91.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000275700", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275700" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "93.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000275700", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275700" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "89.61", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000275700", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275700" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "88.18", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000275700", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275700" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "90.23", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000275700", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275700" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "91.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000275700", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275700" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "Q9NY61", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9NY61" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "common_name": "Human" } ], "gene": [ { "name": "AATF", "url": "https://www.uniprot.org/uniprot/Q9NY61", "locus": { "chromosome": "CHR_HSCHR17_7_CTG4", "start_pos": 37058704, "end_pos": 36950708, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000276072", "url": "https://www.ensembl.org/id/ENSG00000276072" } ] } } ], "crossref": [ { "id": "ENSG00000275700", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000275700", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "AATF", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=AATF", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "26574", "url": "https://www.ncbi.nlm.nih.gov/gene/26574", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "19235", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=19235", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "Q9NY61", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9NY61*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR012617", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012617", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025160", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025160", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039223", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039223", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:26574", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:26574", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "608463", "url": "http://www.omim.org/entry/608463", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q9NY61", "url": "https://www.nextprot.org/entry/NX_Q9NY61", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "Q9NY61", "url": "https://oglcnac.org/atlas/detail/Q9NY61", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q9NY61", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9NY61", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "RRIRYHV", "url": "https://omabrowser.org/oma/group/RRIRYHV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "26012at2759", "url": "http://www.orthodb.org/?query=26012at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15565", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15565", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15565:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15565:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5W6A", "url": "https://www.rcsb.org/structure/5W6A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7MQ8", "url": "https://www.rcsb.org/structure/7MQ8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7MQ9", "url": "https://www.rcsb.org/structure/7MQ9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF08164", "url": "http://pfam.xfam.org/family/PF08164", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13339", "url": "http://pfam.xfam.org/family/PF13339", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "Q9NY61", "url": "https://pharos.nih.gov/targets/Q9NY61", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q9NY61", "url": "http://purl.obolibrary.org/obo/PR_Q9NY61", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_036270", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036270", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WTH8", "url": "https://www.uniprot.org/uniprot/A0A087WTH8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WTH8-1", "url": "https://www.uniprot.org/uniprot/A0A087WTH8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WW41", "url": "https://www.uniprot.org/uniprot/A0A087WW41", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WW41-1", "url": "https://www.uniprot.org/uniprot/A0A087WW41-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WWS8", "url": "https://www.uniprot.org/uniprot/A0A087WWS8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WWS8-1", "url": "https://www.uniprot.org/uniprot/A0A087WWS8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YWE9", "url": "https://www.uniprot.org/uniprot/A0A0J9YWE9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0J9YWE9-1", "url": "https://www.uniprot.org/uniprot/A0A0J9YWE9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T868", "url": "https://www.uniprot.org/uniprot/A0A7P0T868", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0T868-1", "url": "https://www.uniprot.org/uniprot/A0A7P0T868-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TAR0", "url": "https://www.uniprot.org/uniprot/A0A7P0TAR0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TAR0-1", "url": "https://www.uniprot.org/uniprot/A0A7P0TAR0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TBG4", "url": "https://www.uniprot.org/uniprot/A0A7P0TBG4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TBG4-1", "url": "https://www.uniprot.org/uniprot/A0A7P0TBG4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TBI0", "url": "https://www.uniprot.org/uniprot/A0A7P0TBI0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0TBI0-1", "url": "https://www.uniprot.org/uniprot/A0A7P0TBI0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z434", "url": "https://www.uniprot.org/uniprot/A0A7P0Z434", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z434-1", "url": "https://www.uniprot.org/uniprot/A0A7P0Z434-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z4N2", "url": "https://www.uniprot.org/uniprot/A0A7P0Z4N2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z4N2-1", "url": "https://www.uniprot.org/uniprot/A0A7P0Z4N2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z4P2", "url": "https://www.uniprot.org/uniprot/A0A7P0Z4P2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z4P2-1", "url": "https://www.uniprot.org/uniprot/A0A7P0Z4P2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9NY61-1", "url": "https://www.uniprot.org/uniprot/Q9NY61-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDARTELYRSLFGQLHPPDEGHGD", "length": 560, "header": "sp|Q9NY61-1|AATF_HUMAN Isoform 1 of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "isoforms": [ { "isoform_ac": "A0A087WTH8-1", "url": "", "sequence": { "sequence": "MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIGHKALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDARTELYRSLFGQLHPPDEGHGD", "length": 514, "header": "tr|A0A087WTH8-1|A0A087WTH8_HUMAN Computationally mapped isoform of Apoptosis antagonizing transcription factor OS=Homo sapiens OX=9606 GN=AATF PE=3 SV=2 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "17", "start_pos": 37056661, "end_pos": 36949126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000616434.2", "url": "https://www.ensembl.org/id/ENST00000616434.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000477881.2", "url": "https://www.ensembl.org/id/ENSP00000477881.2" } ] } }, { "isoform_ac": "A0A087WW41-1", "url": "", "sequence": { "sequence": "MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGSNYKKLC", "length": 55, "header": "tr|A0A087WW41-1|A0A087WW41_HUMAN Computationally mapped isoform of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "CHR_HSCHR17_7_CTG4", "start_pos": 36955653, "end_pos": 36950959, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000632039.1", "url": "https://www.ensembl.org/id/ENST00000632039.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000488862.1", "url": "https://www.ensembl.org/id/ENSP00000488862.1" } ] } }, { "isoform_ac": "A0A087WWS8-1", "url": "", "sequence": { "sequence": "RNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLR", "length": 154, "header": "tr|A0A087WWS8-1|A0A087WWS8_HUMAN Computationally mapped isoform of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "17", "start_pos": 37021015, "end_pos": 36988658, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000610798.4", "url": "https://www.ensembl.org/id/ENST00000610798.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000480472.1", "url": "https://www.ensembl.org/id/ENSP00000480472.1" } ] } }, { "isoform_ac": "A0A0J9YWE9-1", "url": "", "sequence": { "sequence": "XILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRTELYRSLFGQLHPPDEGHGD", "length": 98, "header": "tr|A0A0J9YWE9-1|AATF_HUMAN Computationally mapped isoform of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "CHR_HSCHR17_7_CTG4", "start_pos": 37058495, "end_pos": 36992607, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000632435.1", "url": "https://www.ensembl.org/id/ENST00000632435.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000487925.1", "url": "https://www.ensembl.org/id/ENSP00000487925.1" } ] } }, { "isoform_ac": "A0A7P0T868-1", "url": "", "sequence": { "sequence": "MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDAR", "length": 540, "header": "tr|A0A7P0T868-1|AATF_HUMAN Computationally mapped isoform of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "17", "start_pos": 37031686, "end_pos": 36949126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679997.1", "url": "https://www.ensembl.org/id/ENST00000679997.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505070.1", "url": "https://www.ensembl.org/id/ENSP00000505070.1" } ] } }, { "isoform_ac": "A0A7P0TAR0-1", "url": "", "sequence": { "sequence": "MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRTELYRSLFGQLHPPDEGHGD", "length": 536, "header": "tr|A0A7P0TAR0-1|AATF_HUMAN Computationally mapped isoform of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "17", "start_pos": 37056661, "end_pos": 36949126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680340.1", "url": "https://www.ensembl.org/id/ENST00000680340.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000506264.1", "url": "https://www.ensembl.org/id/ENSP00000506264.1" } ] } }, { "isoform_ac": "A0A7P0TBG4-1", "url": "", "sequence": { "sequence": "MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNMRRFLVKMMSW", "length": 288, "header": "tr|A0A7P0TBG4-1|AATF_HUMAN Computationally mapped isoform of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "17", "start_pos": 36988550, "end_pos": 36949126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680579.1", "url": "https://www.ensembl.org/id/ENST00000680579.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000506655.1", "url": "https://www.ensembl.org/id/ENSP00000506655.1" } ] } }, { "isoform_ac": "A0A7P0TBI0-1", "url": "", "sequence": { "sequence": "MDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRTELYRSLFGQLHPPDEGHGD", "length": 373, "header": "tr|A0A7P0TBI0-1|AATF_HUMAN Computationally mapped isoform of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "17", "start_pos": 37056661, "end_pos": 36953092, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680782.1", "url": "https://www.ensembl.org/id/ENST00000680782.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000506681.1", "url": "https://www.ensembl.org/id/ENSP00000506681.1" } ] } }, { "isoform_ac": "A0A7P0Z434-1", "url": "", "sequence": { "sequence": "MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGSGLQSRSYEAKSTKK", "length": 503, "header": "tr|A0A7P0Z434-1|AATF_HUMAN Computationally mapped isoform of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "17", "start_pos": 37020980, "end_pos": 36949126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680356.1", "url": "https://www.ensembl.org/id/ENST00000680356.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505146.1", "url": "https://www.ensembl.org/id/ENSP00000505146.1" } ] } }, { "isoform_ac": "A0A7P0Z4N2-1", "url": "", "sequence": { "sequence": "MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQNLLKYWTE", "length": 474, "header": "tr|A0A7P0Z4N2-1|AATF_HUMAN Computationally mapped isoform of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "17", "start_pos": 37016895, "end_pos": 36949126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680330.1", "url": "https://www.ensembl.org/id/ENST00000680330.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000506539.1", "url": "https://www.ensembl.org/id/ENSP00000506539.1" } ] } }, { "isoform_ac": "A0A7P0Z4P2-1", "url": "", "sequence": { "sequence": "MDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDARTELYRSLFGQLHPPDEGHGD", "length": 397, "header": "tr|A0A7P0Z4P2-1|AATF_HUMAN Computationally mapped isoform of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "17", "start_pos": 37056661, "end_pos": 36953092, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679881.1", "url": "https://www.ensembl.org/id/ENST00000679881.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504972.1", "url": "https://www.ensembl.org/id/ENSP00000504972.1" } ] } }, { "isoform_ac": "Q9NY61-1", "url": "", "sequence": { "sequence": "MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDEDDLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQYPDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVLGKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDARTELYRSLFGQLHPPDEGHGD", "length": 560, "header": "sp|Q9NY61-1|AATF_HUMAN Isoform 1 of Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1 CANONICAL=Q9NY61-1" }, "locus": { "chromosome": "17", "start_pos": 37056661, "end_pos": 36949126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000619387.5", "url": "https://www.ensembl.org/id/ENST00000619387.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000477848.1", "url": "https://www.ensembl.org/id/ENSP00000477848.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 143, "start_aa": "Ser", "end_pos": 143, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser143", "evidence": [ { "id": "Q9NY61", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9NY61" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 146, "start_aa": "Thr", "end_pos": 146, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr146", "evidence": [ { "id": "Q9NY61", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9NY61" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 153, "start_aa": "Ser", "end_pos": 153, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser153", "evidence": [ { "id": "Q9NY61", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9NY61" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 155, "start_aa": "Ser", "end_pos": 155, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser155", "evidence": [ { "id": "Q9NY61", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9NY61" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "Q9NY61", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9NY61" } ] } ], "phosphorylation": [ { "start_pos": 104, "end_pos": 104, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser104" }, { "start_pos": 109, "end_pos": 109, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser109" }, { "start_pos": 117, "end_pos": 117, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "phospho.ELM", "id": "Q9NY61", "url": "http://phospho.elm.eu.org/byAccession/Q9NY61.html" } ], "site_lbl": "Tyr117" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "O96017-1", "kinase_gene_name": "CHEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17157788", "url": "https://glygen.org/publication/PubMed/17157788" } ], "site_lbl": "Ser141" }, { "start_pos": 143, "end_pos": 143, "kinase_uniprot_canonical_ac": "O96017-1", "kinase_gene_name": "CHEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17157788", "url": "https://glygen.org/publication/PubMed/17157788" } ], "site_lbl": "Ser143" }, { "start_pos": 150, "end_pos": 150, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "site_lbl": "Ser150" }, { "start_pos": 155, "end_pos": 155, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "Q9NY61", "url": "http://phospho.elm.eu.org/byAccession/Q9NY61.html" } ], "site_lbl": "Ser155" }, { "start_pos": 189, "end_pos": 189, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17157788", "url": "https://glygen.org/publication/PubMed/17157788" } ], "site_lbl": "Ser189" }, { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "Q9NY61", "url": "http://phospho.elm.eu.org/byAccession/Q9NY61.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser203" }, { "start_pos": 218, "end_pos": 218, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser218" }, { "start_pos": 273, "end_pos": 273, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser273" }, { "start_pos": 305, "end_pos": 305, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Tyr305" }, { "start_pos": 310, "end_pos": 310, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "Q9NY61", "url": "http://phospho.elm.eu.org/byAccession/Q9NY61.html" } ], "site_lbl": "Thr310" }, { "start_pos": 316, "end_pos": 316, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "Q9NY61", "url": "http://phospho.elm.eu.org/byAccession/Q9NY61.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser316" }, { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "Q9NY61", "url": "http://phospho.elm.eu.org/byAccession/Q9NY61.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser320" }, { "start_pos": 321, "end_pos": 321, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "Q9NY61", "url": "http://phospho.elm.eu.org/byAccession/Q9NY61.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser321" }, { "start_pos": 366, "end_pos": 366, "kinase_uniprot_canonical_ac": "P49137-1", "kinase_gene_name": "MAPKAPK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "22909821", "url": "https://glygen.org/publication/PubMed/22909821" } ], "site_lbl": "Thr366" }, { "start_pos": 476, "end_pos": 476, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr476" }, { "start_pos": 477, "end_pos": 477, "kinase_uniprot_canonical_ac": "O96017-1", "kinase_gene_name": "CHEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17157788", "url": "https://glygen.org/publication/PubMed/17157788" } ], "site_lbl": "Ser477" }, { "start_pos": 510, "end_pos": 510, "kinase_uniprot_canonical_ac": "O96017-1", "kinase_gene_name": "CHEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17157788", "url": "https://glygen.org/publication/PubMed/17157788" } ], "site_lbl": "Ser510" }, { "start_pos": 61, "end_pos": 61, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "site_lbl": "Ser61" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "site_lbl": "Ser63" }, { "start_pos": 67, "end_pos": 67, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr67" }, { "start_pos": 93, "end_pos": 93, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser93" }, { "start_pos": 94, "end_pos": 94, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser94" }, { "start_pos": 99, "end_pos": 99, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser99" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Identification of a novel partner of RNA polymerase II subunit 11, Che-1, which interacts with and affects the growth suppression function of Rb.", "journal": "FASEB J.", "date": "2000", "authors": "Bruno T., De Angelis R., Di Padova M., Fanciulli M., Floridi A., Iacobini C., Iezzi S., Passananti C.", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "10783144", "url": "https://glygen.org/publication/PubMed/10783144" } ] }, { "title": "Identification of novel transcription factor-like gene from human intestinal cells.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2000", "authors": "Lindfors K, Halttunen T, Huotari P, Nupponen N, Vihinen M, Visakorpi T, Maki M, Kainulainen H", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "11027528", "url": "https://glygen.org/publication/PubMed/11027528" } ] }, { "title": "Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Harrington AW, Kim JY, Yoon SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648" } ], "reference": [ { "type": "PubMed", "id": "11756498", "url": "https://glygen.org/publication/PubMed/11756498" } ] }, { "title": "Mechanisms of p75-mediated death of hippocampal neurons. Role of caspases.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Troy CM, Friedman JE, Friedman WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648" } ], "reference": [ { "type": "PubMed", "id": "12097334", "url": "https://glygen.org/publication/PubMed/12097334" } ] }, { "title": "Functional proteomic analysis of human nucleolus.", "journal": "Mol. Biol. Cell", "date": "2002", "authors": "Scherl A, Coute Y, Deon C, Calle A, Kindbeiter K, Sanchez JC, Greco A, Hochstrasser D, Diaz JJ", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "12429849", "url": "https://glygen.org/publication/PubMed/12429849" } ] }, { "title": "Che-1 affects cell growth by interfering with the recruitment of HDAC1 by Rb.", "journal": "Cancer Cell", "date": "2002", "authors": "Barbato C., Benassi B., Bruno T., Chersi A., Corbi N., De Angelis R., De Nicola F., Di Padova M., Fanciulli M., Floridi A., Libri V., Mattei E., Passananti C., Soddu S.", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "12450794", "url": "https://glygen.org/publication/PubMed/12450794" } ] }, { "title": "Che-1 arrests human colon carcinoma cell proliferation by displacing HDAC1 from the p21WAF1/CIP1 promoter.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Biroccio A., Bruno T., Corbi N., D'Angelo C., De Nicola F., Di Padova M., Fanciulli M., Floridi A., Gallo R., Iezzi S., Nicosia D., Passananti C.", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "12847090", "url": "https://glygen.org/publication/PubMed/12847090" } ] }, { "title": "AATF inhibits aberrant production of amyloid beta peptide 1-42 by interacting directly with Par-4.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Guo Q, Xie J", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "14627703", "url": "https://glygen.org/publication/PubMed/14627703" } ] }, { "title": "Apoptosis induced by p75NTR overexpression requires Jun kinase-dependent phosphorylation of Bad.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2003", "authors": "Bhakar AL, Howell JL, Paul CE, Salehi AH, Becker EB, Said F, Bonni A, Barker PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648" } ], "reference": [ { "type": "PubMed", "id": "14673001", "url": "https://glygen.org/publication/PubMed/14673001" } ] }, { "title": "Rb binding protein Che-1 interacts with Tau in cerebellar granule neurons. Modulation during neuronal apoptosis.", "journal": "Mol. Cell. Neurosci.", "date": "2003", "authors": "Amadoro G., Barbato C., Bruno T., Calissano P., Canu N., Ciotti M., Corbi N., De Angelis R., Fanciulli M., Libri V., Passananti C., Serafino A.", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "14697667", "url": "https://glygen.org/publication/PubMed/14697667" } ] }, { "title": "AATF protects neural cells against oxidative damage induced by amyloid beta-peptide.", "journal": "Neurobiol. Dis.", "date": "2004", "authors": "Xie J., Guo Q.", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "15207272", "url": "https://glygen.org/publication/PubMed/15207272" } ] }, { "title": "Characterization of the c-Jun N-terminal kinase-BimEL signaling pathway in neuronal apoptosis.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Becker EB, Howell J, Kodama Y, Barker PA, Bonni A", "evidence": [ { "database": "Reactome", "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648" } ], "reference": [ { "type": "PubMed", "id": "15470142", "url": "https://glygen.org/publication/PubMed/15470142" } ] }, { "title": "Phosphoproteome analysis of the human mitotic spindle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Che-1 phosphorylation by ATM/ATR and Chk2 kinases activates p53 transcription and the G2/M checkpoint.", "journal": "Cancer cell", "date": "2006", "authors": "Bruno T, De Nicola F, Iezzi S, Lecis D, D'Angelo C, Di Padova M, Corbi N, Dimiziani L, Zannini L, Jekimovs C, Scarsella M, Porrello A, Chersi A, Crescenzi M, Leonetti C, Khanna KK, Soddu S, Floridi A, Passananti C, Delia D, Fanciulli M", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "17157788", "url": "https://glygen.org/publication/PubMed/17157788" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative analysis of the human spindle phosphoproteome at distinct mitotic stages.", "journal": "Journal of proteome research", "date": "2009", "authors": "Malik R, Lenobel R, Santamaria A, Ries A, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "AATF/Che-1 acts as a phosphorylation-dependent molecular modulator to repress p53-driven apoptosis.", "journal": "The EMBO journal", "date": "2012", "authors": "Hopker K, Hagmann H, Khurshid S, Chen S, Hasskamp P, Seeger-Nukpezah T, Schilberg K, Heukamp L, Lamkemeyer T, Sos ML, Thomas RK, Lowery D, Roels F, Fischer M, Liebau MC, Resch U, Kisner T, Rother F, Bartram MP, Muller RU, Fabretti F, Kurschat P, Schumacher B, Gaestel M, Medema RH, Yaffe MB, Schermer B, Reinhardt HC, Benzing T", "evidence": [ { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "22909821", "url": "https://glygen.org/publication/PubMed/22909821" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" }, { "database": "iPTMnet", "id": "Q9NY61", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9NY61", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Che-1/AATF binds to RNA polymerase I machinery and sustains ribosomal RNA gene transcription.", "journal": "Nucleic acids research", "date": "2020", "authors": "Sorino C, Catena V, Bruno T, De Nicola F, Scalera S, Bossi G, Fabretti F, Mano M, De Smaele E, Fanciulli M, Iezzi S", "evidence": [ { "database": "RefSeq", "id": "NP_036270", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036270" } ], "reference": [ { "type": "PubMed", "id": "32421830", "url": "https://glygen.org/publication/PubMed/32421830" } ] }, { "title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.", "journal": "The Analyst", "date": "2021", "authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9NY61", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9NY61" }, { "database": "O-GlcNAc Atlas", "id": "Q9NY61", "url": "https://oglcnac.org/atlas/detail/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "33465208", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "title": "CK2-mediated phosphorylation of Che-1/AATF is required for its pro-proliferative activity.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2021", "authors": "Catena V, Bruno T, Iezzi S, Matteoni S, Salis A, Sorino C, Damonte G, Fanciulli M", "evidence": [ { "database": "RefSeq", "id": "NP_036270", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_036270" } ], "reference": [ { "type": "PubMed", "id": "34266450", "url": "https://glygen.org/publication/PubMed/34266450" } ] }, { "title": "Nucleolar maturation of the human small subunit processome.", "journal": "Science", "date": "2021", "authors": "Singh S., Miller L., Chaker-Margot M., Klinge S., Vanden Broeck A.", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "reference": [ { "type": "PubMed", "id": "34516797", "url": "https://glygen.org/publication/PubMed/34516797" } ] }, { "title": "The small GTP-binding protein Cdc42 is required for nerve growth factor withdrawal-induced neuronal death.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Bazenet CE, Mota MA, Rubin LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648" } ], "reference": [ { "type": "PubMed", "id": "9520479", "url": "https://glygen.org/publication/PubMed/9520479" } ] } ], "pathway": [ { "id": "hsa:26574", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:26574", "resource": "KEGG Pathway" }, { "id": "R-HSA-193648", "name": "NRAGE signals death through JNK", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648", "resource": "Reactome", "description": "NRAGE signals death through JNK" } ], "orthologs": [ { "uniprot_canonical_ac": "Q06631-1", "protein_name": "Protein BFR2", "gene_name": "BFR2", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MEKSLADQISDIAIKPVNKDFDIEDEENASLFQHNEKNGESDLSDYGNSNTEETKKAHYLEVEKSKLRAEKGLELNDPKYTGVKGSRQALYEEVSENEDEEEEEEEEEEKEEDALSFRTDSEDEEVEIDEEESDADGGETEEAQQKRHALSKLIQQETKQAINKLSQSVQRDASKGYSILQQTKLFDNIIDLRIKLQKAVIAANKLPLTTESWEEAKMDDSEETKRLLKENEKLFNNLFNRLINFRIKFQLGDHITQNEEVAKHKLSKKRSLKELYQETNSLDSELKEYRTAVLNKWSTKVSSASGNAALSSNKFKAINLPADVQVENQLSDMSRLMKRTKLNRRNITPLYFQKDCANGRLPELISPVVKDSVDDNENSDDGLDIPKNYDPRRKDNNAIDITENPYVFDDEDFYRVLLNDLIDKKISNAHNSESAAITITSTNARSNNKLKKNIDTKASKGRKLNYSVQDPIANYEAPITSGYKWSDDQIDEFFAGLLGQRVNFNENEDEEQHARIENDEELEAVKNDDIQIFG", "length": 534 }, "evidence": [ { "id": "Q9NY61", "url": "https://omabrowser.org/oma/group/Q9NY61/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q9JKX4-1", "protein_name": "Protein AATF", "gene_name": "Aatf", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAPQPLALQLEQLLNPRPREADPEADPEEATRARVIDRFDEGEEEKDDLAVSSIRKLAPVSLLDTDKRYSGKTTSRKAWKEDHWEQALPSSSDNEASDEGGSEDGDSEGLGLEEISEDVDEDLEDNKISDEGGSEDGDSEGLGLEEFSEDVEEDLEGEDEEDREEDRNSEDDGVVAAFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPVFKDKGGPEFASALKNSHKALKALLRSLVDLQEELLFQYPDTRHIVNGAKPNTESEEISSEDDELVGEKKKQRKAPPKRKLEMEDYPSFMAKRFADFTIYRNHTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHIMMDKERLLRRTQTKRSAYRVLGKPEPVPEPVAETLPGEPETLPQGPANAHLRDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIRKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTAMSDDARTELFRSLFGQLNPPDADRGK", "length": 526 }, "evidence": [ { "id": "45237978", "url": "http://www.informatics.jax.org/homology/45237978", "database": "MGI" }, { "id": "Q9NY61", "url": "https://omabrowser.org/oma/group/Q9NY61/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9QYW0-1", "protein_name": "Protein AATF", "gene_name": "Aatf", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAELQPLALQLEQLLNPRPREADPEADPEEATRARVIDRFDEGEEEEDDLPVSSIRKLAPVSLLDTDKRYSGKTTSRKAWKEDHWDQTLPSSSDNEIPDEGGSEAGDSEGLEELSEDVEEDLEDNEIPDEGGSEDGDSEGLEEEISEDVEEDLEGEDEEDREEDRNSEDDGVVMAFSGVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPVFKDKGGPEFASALKNSHKALKALLRSLVDLQEELLFQYPDTRYLVKGTKPNAESEEISSEDDELVGEKKKQRKAPPKRKLEMEDYPSFMAKRSADFTVYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSAYRVLGKPEPVPEPVAETLPGEPESLPQVPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLDPNDQVAMGRQWLAIQKLRSKIRKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTAMNDEARTELYRSLFGQLNRLDADHGQ", "length": 523 }, "evidence": [ { "id": "45237978", "url": "http://www.informatics.jax.org/homology/45237978", "database": "MGI" }, { "id": "Q9NY61", "url": "https://omabrowser.org/oma/group/Q9NY61/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9VM95-1", "protein_name": "Protein Aatf", "gene_name": "Aatf", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MLRKSKKQPQTVAEKVSKLLAHPNESDSAEDSDFDVATGPRLVDFEEEEYDLPDARSTDFRKRNVKLLSEQSDRYKGKISSRKELDDDEDKDDEQEVSYEESDEDDENLTNFKQKLNAGGAEDSEEETAAGHSESGEESEEIESNLTDFKKKFEAGDFKYDDDEEEDDDSEEEDHSQESEGDDDDSEDDEAEDDAIKPSDVMSKTNHQAEIQKGLAVQNQLRIWERLLELRINTQKFTSKANQLPAPETLTKLASESDELQSVLNEAQERSSKLLQQLLSLQSALHQQYSEMKKSVKRKQPTEDSGPAVKKFGSVLQSNFQQMIGYRNEVLLKWDDRTKLLTPGAGVKRKSLQEDYDIIKKIGSALANREALVEKSQTPKNSQAEQQENTPVQRLKHIYDDSDFYHQQLRELIEYKASTSSNMSEITKQFVELQKLRQKMKKKVDTRASKGRKLRYVVHNKLINFMAPNESSDWTDASKSELYKSLFV", "length": 488 }, "evidence": [ { "id": "Q9NY61", "url": "https://omabrowser.org/oma/group/Q9NY61/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "small-subunit processome", "id": "GO:0032040", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032040", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "leucine zipper domain binding", "id": "GO:0043522", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043522", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "tau protein binding", "id": "GO:0048156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048156", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "regulation of mitotic cell cycle", "id": "GO:0007346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007346", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "negative regulation of superoxide anion generation", "id": "GO:0032929", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032929", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "embryonic cleavage", "id": "GO:0040016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040016", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "negative regulation of amyloid precursor protein biosynthetic process", "id": "GO:0042985", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042985", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "negative regulation of reactive oxygen species metabolic process", "id": "GO:2000378", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000378", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "negative regulation of apoptotic signaling pathway", "id": "GO:2001234", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001234", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" }, { "name": "ribosomal small subunit biogenesis", "id": "GO:0042274", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042274", "evidence": [ { "database": "UniProtKB", "id": "Q9NY61", "url": "https://www.uniprot.org/uniprot/Q9NY61" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 364, "end_pos": 366, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 26 }, { "field": "total_sites", "count": 26 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }