{ "uniprot_canonical_ac": "Q9NIP6-1", "uniprot_ac": "Q9NIP6", "uniprot_id": "CP2B_DROME", "mass": { "chemical_mass": 16507.0, "monoisotopic_mass": 16507.0 }, "refseq": { "ac": "NP_524552", "name": "capability", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524552" }, "gene_names": [ { "name": "Capa", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9NIP6", "id": "Q9NIP6" }, { "name": "CAP; Cap-1; Cap-2; Cap-2b; CAP-2b; Cap-3; CAP2b; CAP2b-1; CAP2B-1; CAP2b-2; CAP2B-2; CAP2b-3; CAP2B-3; CAP2B/pyrokinin; capa; CAPA; capa 2; capa-1; Capa-1; capa-2; Capa-2; capa-3; Capa-PK; CAPA-PK; CAPA-PVK-1; CAPA-PVK-2; CAPA-PVK/PK; CAP[[2b]]; CG15520; CPPB; Dmel\\CG15520; Drm-CAP-1; Drm-CAP-2; Drm-CAP2b/MT; Drm-capa-1; Drm-MT; Drm-PK; Drm-PK-1; Drm-PVK; Drm-PVK-1; Drm-PVK-2; Drome-capa-1; PVK-2; pyrokinin/PBAN-like", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524552", "id": "NP_524552" }, { "name": "CG15520", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9NIP6", "id": "Q9NIP6" }, { "name": "Capa", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524552", "id": "NP_524552" }, { "name": "MT-CAP2b", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9NIP6", "id": "Q9NIP6" } ], "protein_names": [ { "name": "Cardio acceleratory peptide 2b", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9NIP6" }, { "name": "CAP2b-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NIP6" }, { "name": "CAP2b-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NIP6" }, { "name": "CAP2b-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NIP6" }, { "name": "CG15520-PA; Capa-PA; CAP2B-like; pyrokinin; pyrokinin-like; cardio acceleratory peptide; Drm-myotropin; myotropin-CAP2b-like; TGPSASSGLWFGPRLamide; pyrokinin-1; cardioacceleratory peptide-2b; periviscerokinin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524552", "id": "NP_524552" }, { "name": "Capa-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NIP6" }, { "name": "Capa-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NIP6" }, { "name": "Capa-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NIP6" }, { "name": "Capability protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NIP6" }, { "name": "Myotropin-CAP2b-like protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NIP6" }, { "name": "Myotropin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NIP6" }, { "name": "Pyrokinin-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9NIP6" }, { "name": "capability", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524552", "id": "NP_524552" } ], "function": [ { "annotation": "CAP-1 and CAP-2, but not CAP-3 are ligands for the Capa receptor (PubMed:12177421, PubMed:12459185). CAP-1 and CAP-2 are probably components of the signal transduction pathway that leads to Malpighian tubule fluid secretion via the second messenger nitric oxide (PubMed:11959669). CAP-3 is a ligand for the PK1-R G-protein coupled receptor (PubMed:16054112).", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6#function" }, { "database": "PubMed", "id": "12177421", "url": "https://glygen.org/publication/PubMed/12177421" }, { "database": "PubMed", "id": "12459185", "url": "https://glygen.org/publication/PubMed/12459185" }, { "database": "PubMed", "id": "16054112", "url": "https://glygen.org/publication/PubMed/16054112" }, { "database": "PubMed", "id": "11959669", "url": "https://glygen.org/publication/PubMed/11959669" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "common_name": "Fruit fly" } ], "gene": [ { "name": "Capa", "url": "https://www.uniprot.org/uniprot/Q9NIP6", "locus": { "chromosome": "3R", "start_pos": 29912991, "end_pos": 29914346, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "FBgn0039722", "url": "https://www.ensembl.org/id/FBgn0039722" } ] } } ], "crossref": [ { "id": "FBgn0039722", "url": "https://bgee.org/?page=gene&gene_id=FBgn0039722", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "FBgn0039722", "url": "https://flybase.org/reports/FBgn0039722", "database": "FlyBase", "categories": [ "Organism-specific" ] }, { "id": "43541", "url": "https://www.ncbi.nlm.nih.gov/gene/43541", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9NIP6", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9NIP6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013231", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013231", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "dme:Dmel_CG15520", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG15520", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SMLVHIV", "url": "https://omabrowser.org/oma/group/SMLVHIV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3613035at2759", "url": "http://www.orthodb.org/?query=3613035at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PF08259", "url": "http://pfam.xfam.org/family/PF08259", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9NIP6", "url": "http://purl.obolibrary.org/obo/PR_Q9NIP6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_524552", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_524552", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9NIP6-1", "url": "https://www.uniprot.org/uniprot/Q9NIP6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKSMLVHIVLVIFIIAEFSTAETDHDKNRRGANMGLYAFPRVGRSDPSLANSLRDGLEAGVLDGIYGDASQEDYNEADFQKKASGLVAFPRVGRGDAELRKWAHLLALQQVLDKRTGPSASSGLWFGPRLGKRSVDAKSFADISKGQKELN", "length": 151, "header": "sp|Q9NIP6-1|CP2B_DROME Isoform 1 of Cardio acceleratory peptide 2b OS=Drosophila melanogaster OX=7227 GN=Capa PE=1 SV=1 CANONICAL=Q9NIP6-1" }, "isoforms": [ { "isoform_ac": "Q9NIP6-1", "url": "", "sequence": { "sequence": "MKSMLVHIVLVIFIIAEFSTAETDHDKNRRGANMGLYAFPRVGRSDPSLANSLRDGLEAGVLDGIYGDASQEDYNEADFQKKASGLVAFPRVGRGDAELRKWAHLLALQQVLDKRTGPSASSGLWFGPRLGKRSVDAKSFADISKGQKELN", "length": 151, "header": "sp|Q9NIP6-1|CP2B_DROME Isoform 1 of Cardio acceleratory peptide 2b OS=Drosophila melanogaster OX=7227 GN=Capa PE=1 SV=1 CANONICAL=Q9NIP6-1" }, "locus": { "chromosome": "3R", "start_pos": 29914257, "end_pos": 29913144, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "FBtr0085514", "url": "https://www.ensembl.org/id/FBtr0085514" }, { "database": "Ensembl Peptide", "id": "FBpp0084880", "url": "https://www.ensembl.org/id/FBpp0084880" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome sequence of Drosophila melanogaster.", "journal": "Science", "date": "2000", "authors": "Adams MD, Celniker SE, Holt RA, Evans CA, Gocayne JD, Amanatides PG, Scherer SE, Li PW, Hoskins RA, Galle RF, George RA, Lewis SE, Richards S, Ashburner M, Henderson SN, Sutton GG, Wortman JR, Yandell MD, Zhang Q, Chen LX, Brandon RC, Rogers YH, Blazej RG, Champe M, Pfeiffer BD, Wan KH, Doyle C, Baxter EG, Helt G, Nelson CR, Gabor GL, Abril JF, Agbayani A, An HJ, Andrews-Pfannkoch C, Baldwin D, Ballew RM, Basu A, Baxendale J, Bayraktaroglu L, Beasley EM, Beeson KY, Benos PV, Berman BP, Bhandari D, Bolshakov S, Borkova D, Botchan MR, Bouck J, Brokstein P, Brottier P, Burtis KC, Busam DA, Butler H, Cadieu E, Center A, Chandra I, Cherry JM, Cawley S, Dahlke C, Davenport LB, Davies P, de Pablos B, Delcher A, Deng Z, Mays AD, Dew I, Dietz SM, Dodson K, Doup LE, Downes M, Dugan-Rocha S, Dunkov BC, Dunn P, Durbin KJ, Evangelista CC, Ferraz C, Ferriera S, Fleischmann W, Fosler C, Gabrielian AE, Garg NS, Gelbart WM, Glasser K, Glodek A, Gong F, Gorrell JH, Gu Z, Guan P, Harris M, Harris NL, Harvey D, Heiman TJ, Hernandez JR, Houck J, Hostin D, Houston KA, Howland TJ, Wei MH, Ibegwam C, Jalali M, Kalush F, Karpen GH, Ke Z, Kennison JA, Ketchum KA, Kimmel BE, Kodira CD, Kraft C, Kravitz S, Kulp D, Lai Z, Lasko P, Lei Y, Levitsky AA, Li J, Li Z, Liang Y, Lin X, Liu X, Mattei B, McIntosh TC, McLeod MP, McPherson D, Merkulov G, Milshina NV, Mobarry C, Morris J, Moshrefi A, Mount SM, Moy M, Murphy B, Murphy L, Muzny DM, Nelson DL, Nelson DR, Nelson KA, Nixon K, Nusskern DR, Pacleb JM, Palazzolo M, Pittman GS, Pan S, Pollard J, Puri V, Reese MG, Reinert K, Remington K, Saunders RD, Scheeler F, Shen H, Shue BC, Siden-Kiamos I, Simpson M, Skupski MP, Smith T, Spier E, Spradling AC, Stapleton M, Strong R, Sun E, Svirskas R, Tector C, Turner R, Venter E, Wang AH, Wang X, Wang ZY, Wassarman DA, Weinstock GM, Weissenbach J, Williams SM, WoodageT, Worley KC, Wu D, Yang S, Yao QA, Ye J, Yeh RF, Zaveri JS, Zhan M, Zhang G, Zhao Q, Zheng L, Zheng XH, Zhong FN, Zhong W, Zhou X, Zhu S, Zhu X, Smith HO, Gibbs RA, Myers EW, Rubin GM, Venter JC", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "reference": [ { "type": "PubMed", "id": "10731132", "url": "https://glygen.org/publication/PubMed/10731132" } ] }, { "title": "Neuropeptides and their precursors in the fruitfly, Drosophila melanogaster.", "journal": "Peptides", "date": "2001", "authors": "Vanden Broeck J.J.M.", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "reference": [ { "type": "PubMed", "id": "11179818", "url": "https://glygen.org/publication/PubMed/11179818" } ] }, { "title": "Two nitridergic peptides are encoded by the gene capability in Drosophila melanogaster.", "journal": "Am. J. Physiol.", "date": "2002", "authors": "Davies S.A., Graham S., Dow J.A., Veenstra J.A., Kean L., Pollock V.P., Broderick K.E., Cazenave W., Costes L.", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "reference": [ { "type": "PubMed", "id": "11959669", "url": "https://glygen.org/publication/PubMed/11959669" } ] }, { "title": "Peptidomics of the larval Drosophila melanogaster central nervous system.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Baggerman G, Cerstiaens A, De Loof A, Schoofs L", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "reference": [ { "type": "PubMed", "id": "12171930", "url": "https://glygen.org/publication/PubMed/12171930" } ] }, { "title": "Identification of G protein-coupled receptors for Drosophila PRXamide peptides, CCAP, corazonin, and AKH supports a theory of ligand-receptor coevolution.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2002", "authors": "Park Y., Adams M.E., Kim Y.-J.", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "reference": [ { "type": "PubMed", "id": "12177421", "url": "https://glygen.org/publication/PubMed/12177421" } ] }, { "title": "Molecular cloning and functional expression of a Drosophila receptor for the neuropeptides capa-1 and -2.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2002", "authors": "Williamson M., Hauser F., Cazzamali G., Grimmelikhuijzen C.J.P., Iversen A.", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "reference": [ { "type": "PubMed", "id": "12459185", "url": "https://glygen.org/publication/PubMed/12459185" } ] }, { "title": "A Drosophila full-length cDNA resource.", "journal": "Genome Biol.", "date": "2002", "authors": "Stapleton M, Carlson J, Brokstein P, Yu C, Champe M, George R, Guarin H, Kronmiller B, Pacleb J, Park S, Wan K, Rubin GM, Celniker SE", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "reference": [ { "type": "PubMed", "id": "12537569", "url": "https://glygen.org/publication/PubMed/12537569" } ] }, { "title": "Annotation of the Drosophila melanogaster euchromatic genome: a systematic review.", "journal": "Genome Biol.", "date": "2002", "authors": "Misra S, Crosby MA, Mungall CJ, Matthews BB, Campbell KS, Hradecky P, Huang Y, Kaminker JS, Millburn GH, Prochnik SE, Smith CD, Tupy JL, Whitfied EJ, Bayraktaroglu L, Berman BP, Bettencourt BR, Celniker SE, de Grey AD, Drysdale RA, Harris NL, Richter J, Russo S, Schroeder AJ, Shu SQ, Stapleton M, Yamada C, Ashburner M, Gelbart WM, Rubin GM, Lewis SE", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "reference": [ { "type": "PubMed", "id": "12537572", "url": "https://glygen.org/publication/PubMed/12537572" } ] }, { "title": "The Drosophila gene CG9918 codes for a pyrokinin-1 receptor.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2005", "authors": "Williamson M., Hauser F., Torp M., Cazzamali G., Grimmelikhuijzen C.J.", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "reference": [ { "type": "PubMed", "id": "16054112", "url": "https://glygen.org/publication/PubMed/16054112" } ] } ], "pathway": [ { "id": "dme:Dmel_CG15520", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+dme:Dmel_CG15520", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "epithelial fluid transport", "id": "GO:0042045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042045", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "pmid": "" }, { "name": "positive regulation of cytosolic calcium ion concentration", "id": "GO:0007204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007204", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "pmid": "" }, { "name": "neuropeptide signaling pathway", "id": "GO:0007218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007218", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "pmid": "" }, { "name": "monoatomic cation transport", "id": "GO:0006812", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006812", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "pmid": "" }, { "name": "nitric oxide-cGMP-mediated signaling pathway", "id": "GO:0038060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038060", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "neuropeptide hormone activity", "id": "GO:0005184", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005184", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "pmid": "" }, { "name": "neuropeptide receptor binding", "id": "GO:0071855", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071855", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "pmid": "" }, { "name": "diuretic hormone activity", "id": "GO:0008613", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008613", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "pmid": "" }, { "name": "myostimulatory hormone activity", "id": "GO:0016084", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016084", "evidence": [ { "database": "UniProtKB", "id": "Q9NIP6", "url": "https://www.uniprot.org/uniprot/Q9NIP6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }