{ "uniprot_canonical_ac": "Q9JLJ0-1", "uniprot_ac": "Q9JLJ0", "uniprot_id": "LITAF_MOUSE", "mass": { "chemical_mass": 16946.0, "monoisotopic_mass": 16946.0 }, "refseq": { "ac": "NP_064364", "name": "lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364" }, "gene_names": [ { "name": "Litaf", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9JLJ0", "id": "Q9JLJ0" }, { "name": "3222402J11Rik; N4WBP3; TBX1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364", "id": "NP_064364" }, { "name": "Litaf", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364", "id": "NP_064364" }, { "name": "N4wbp3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9JLJ0", "id": "Q9JLJ0" }, { "name": "Tbx1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9JLJ0", "id": "Q9JLJ0" } ], "protein_names": [ { "name": "Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9JLJ0" }, { "name": "Estrogen-enhanced transcript protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JLJ0" }, { "name": "LITAF-like protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JLJ0" }, { "name": "LPS-induced TNF-alpha factor homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JLJ0" }, { "name": "NEDD4 WW domain-binding protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JLJ0" }, { "name": "lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364", "id": "NP_064364" }, { "name": "mEET; LITAF-like protein; LPS-induced TNF-alpha factor homolog; estrogen-enhanced transcript protein; Nedd4 WW domain-binding protein 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364", "id": "NP_064364" }, { "name": "mEET", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JLJ0" } ], "function": [ { "annotation": "LITAF acts as a novel regulator for pathological cardiac hypertrophy.", "evidence": [ { "database": "RefSeq", "id": "NP_064364", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364" }, { "database": "PubMed", "id": "33823186", "url": "https://glygen.org/publication/PubMed/33823186" } ] }, { "annotation": "Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation. Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps down-regulate downstream signaling cascades (PubMed:23166352). Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes. Probably plays a role in regulating protein degradation via its interaction with NEDD4 (By similarity). May also contribute to the regulation of gene expression in the nucleus. Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines (PubMed:15793005, PubMed:21980379). May regulate the expression of numerous cytokines, such as TNF, CCL2, CCL5, CXCL1, IL1A and IL10 (PubMed:12355436, PubMed:15025820, PubMed:16954198, PubMed:21980379, PubMed:22160695).", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0#function" }, { "database": "PubMed", "id": "21980379", "url": "https://glygen.org/publication/PubMed/21980379" }, { "database": "PubMed", "id": "16954198", "url": "https://glygen.org/publication/PubMed/16954198" }, { "database": "PubMed", "id": "15793005", "url": "https://glygen.org/publication/PubMed/15793005" }, { "database": "PubMed", "id": "23166352", "url": "https://glygen.org/publication/PubMed/23166352" }, { "database": "PubMed", "id": "15025820", "url": "https://glygen.org/publication/PubMed/15025820" }, { "database": "UniProtKB", "id": "Q99732", "url": "https://www.uniprot.org/uniprot/Q99732#function" }, { "database": "PubMed", "id": "12355436", "url": "https://glygen.org/publication/PubMed/12355436" } ] }, { "annotation": "Results indicate that SIMPLE may regulate protein trafficking physiologically by localizing to the TGN and/or REs by binding PI4P. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_064364", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364" }, { "database": "PubMed", "id": "29953492", "url": "https://glygen.org/publication/PubMed/29953492" } ] }, { "annotation": "SIMPLE Is an Endosomal Regulator That Protects Against NAFLD by Targeting the Lysosomal Degradation of EGFR.", "evidence": [ { "database": "RefSeq", "id": "NP_064364", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364" }, { "database": "PubMed", "id": "34320238", "url": "https://glygen.org/publication/PubMed/34320238" } ] }, { "annotation": "Sequential CRISPR-Based Screens Identify LITAF and CDIP1 as the Bacillus cereus Hemolysin BL Toxin Host Receptors.", "evidence": [ { "database": "RefSeq", "id": "NP_064364", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364" }, { "database": "PubMed", "id": "32544461", "url": "https://glygen.org/publication/PubMed/32544461" } ] } ], "disease": [ { "disease_id": "DOID:0110151", "recommended_name": { "id": "DOID:0110151", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110151", "name": "Charcot-Marie-Tooth disease type 1C", "description": "A Charcot-Marie-Tooth disease type 1 that has_material_basis_in heterozygous mutation in the LITAF gene on chromosome 16p13." }, "synonyms": [ { "id": "DOID:0110151", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110151", "name": "CMT slow nerve conduction type C", "description": "" }, { "id": "DOID:0110151", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110151", "name": "CMT1C", "description": "" }, { "id": "DOID:0110151", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110151", "name": "Charcot-Marie-Tooth neuropathy type 1C", "description": "" }, { "id": "DOID:0110151", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110151", "name": "HMSN IC", "description": "" }, { "id": "DOID:0110151", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110151", "name": "HMSN1C", "description": "" }, { "id": "DOID:0110151", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110151", "name": "neuropathy hereditary motor and sensory type 1C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "Charcot-Marie-Tooth disease type 1C", "description": "Any Charcot-Marie-Tooth disease type 1 in which the cause of the disease is a mutation in the LITAF gene." }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "CMT slow nerve conduction type C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "CMT1C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "Charcot-Marie-Tooth disease type 1 caused by mutation in LITAF", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "Charcot-Marie-Tooth disease, type 1C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "Charcot-Marie-Tooth neuropathy type 1C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "HMSN IC", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "HMSN1C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "LITAF Charcot-Marie-Tooth disease type 1", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "neuropathy hereditary motor and sensory type 1C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "CMT 1C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "CMT, slow nerve conduction type C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "Charcot Marie Tooth disease type 1C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "Charcot-Marie-Tooth disease, demyelinating, type 1C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "Charcot-Marie-Tooth neuropathy, type 1C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "HMSN 1C", "description": "" }, { "id": "MONDO:0010995", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010995", "name": "neuropathy, hereditary motor and sensory, type 1C", "description": "" }, { "id": "MIM:601098", "resource": "MIM", "url": "https://www.omim.org/entry/601098", "name": "Charcot-Marie-Tooth disease, demyelinating, 1C", "description": "Charcot-Marie-Tooth disease, demyelinating, 1C" } ], "evidence": [ { "id": "0110151", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110151" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 23, "end_pos": 23, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolishes interaction with NEDD4.", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" }, { "database": "PubMed", "id": "11042109", "url": "https://glygen.org/publication/PubMed/11042109" } ] }, { "start_pos": 61, "end_pos": 61, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on interaction with NEDD4.", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" }, { "database": "PubMed", "id": "11042109", "url": "https://glygen.org/publication/PubMed/11042109" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Litaf", "url": "https://www.uniprot.org/uniprot/Q9JLJ0", "locus": { "chromosome": "16", "start_pos": 10777139, "end_pos": 10884021, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000022500", "url": "https://www.ensembl.org/id/ENSMUSG00000022500" } ] } } ], "crossref": [ { "id": "ENSMUSG00000022500", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000022500", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "56722", "url": "https://www.ncbi.nlm.nih.gov/gene/56722", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9JLJ0", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9JLJ0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006629", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006629", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037519", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037519", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:56722", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56722", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1929512", "url": "http://www.informatics.jax.org/marker/MGI:1929512", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "VTFYDRP", "url": "https://omabrowser.org/oma/group/VTFYDRP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1383925at2759", "url": "http://www.orthodb.org/?query=1383925at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23292", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23292", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23292:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23292:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF10601", "url": "http://pfam.xfam.org/family/PF10601", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9JLJ0", "url": "http://purl.obolibrary.org/obo/PR_Q9JLJ0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_064364", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "E0CYR5", "url": "https://www.uniprot.org/uniprot/E0CYR5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E0CYR5-1", "url": "https://www.uniprot.org/uniprot/E0CYR5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JLJ0-1", "url": "https://www.uniprot.org/uniprot/Q9JLJ0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSAPGPYQAAAGPSVVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPSYYTQPVPVPNANAIAVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKRL", "length": 161, "header": "sp|Q9JLJ0-1|LITAF_MOUSE Isoform 1 of Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Mus musculus OX=10090 GN=Litaf PE=1 SV=1 CANONICAL=Q9JLJ0-1" }, "isoforms": [ { "isoform_ac": "E0CYR5-1", "url": "", "sequence": { "sequence": "MSAPGPYQAAAGPSVVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPSYYTQPVPVPNANAIAVQTVYVQQPVSFYDRPVQMCCP", "length": 97, "header": "tr|E0CYR5-1|LITAF_MOUSE Computationally mapped isoform of Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Mus musculus OX=10090 GN=Litaf PE=1 SV=1 CANONICAL=Q9JLJ0-1" }, "locus": { "chromosome": "16", "start_pos": 10784508, "end_pos": 10781207, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000162323.2", "url": "https://www.ensembl.org/id/ENSMUST00000162323.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000123948.2", "url": "https://www.ensembl.org/id/ENSMUSP00000123948.2" } ] } }, { "isoform_ac": "Q9JLJ0-1", "url": "", "sequence": { "sequence": "MSAPGPYQAAAGPSVVPTAPPTYEETVGVNSYYPTPPAPMPGPATGLITGPDGKGMNPPSYYTQPVPVPNANAIAVQTVYVQQPVSFYDRPVQMCCPSCSKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKRL", "length": 161, "header": "sp|Q9JLJ0-1|LITAF_MOUSE Isoform 1 of Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog OS=Mus musculus OX=10090 GN=Litaf PE=1 SV=1 CANONICAL=Q9JLJ0-1" }, "locus": { "chromosome": "16", "start_pos": 10784508, "end_pos": 10778810, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000023143", "url": "https://www.ensembl.org/id/ENSMUST00000023143" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000023143", "url": "https://www.ensembl.org/id/ENSMUSP00000023143" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Identification of multiple proteins expressed in murine embryos as binding partners for the WW domains of the ubiquitin-protein ligase Nedd4.", "journal": "Biochem. J.", "date": "2000", "authors": "Jolliffe CN, Harvey KF, Haines BP, Parasivam G, Kumar S", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "reference": [ { "type": "PubMed", "id": "11042109", "url": "https://glygen.org/publication/PubMed/11042109" } ] }, { "title": "Negative regulation of monocyte chemoattractant protein-1 gene expression by a mouse estrogen-enhanced transcript.", "journal": "Eur. J. Immunol.", "date": "2002", "authors": "Chen W.-F., Dong X.-Y., Jin C., Fu W.-X., Xie L.-P.", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "reference": [ { "type": "PubMed", "id": "12355436", "url": "https://glygen.org/publication/PubMed/12355436" } ] }, { "title": "Molecular cloning and characterization of mouse LITAF cDNA: role in the regulation of tumor necrosis factor-alpha (TNF-alpha) gene expression.", "journal": "J. Endotoxin Res.", "date": "2004", "authors": "Mattei M.-G., Fenton M., Amar S., Bolcato-Bellemin A.-L.", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "reference": [ { "type": "PubMed", "id": "15025820", "url": "https://glygen.org/publication/PubMed/15025820" } ] }, { "title": "LPS induces the interaction of a transcription factor, LPS-induced TNF-alpha factor, and STAT6(B) with effects on multiple cytokines.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2005", "authors": "Tang X., Amar S., Leeman S.E., Marciano D.L.", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "reference": [ { "type": "PubMed", "id": "15793005", "url": "https://glygen.org/publication/PubMed/15793005" } ] }, { "title": "LPS-induced TNF-alpha factor (LITAF)-deficient mice express reduced LPS-induced cytokine: Evidence for LITAF-dependent LPS signaling pathways.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2006", "authors": "Tang X., Metzger D., Amar S., Leeman S.", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "reference": [ { "type": "PubMed", "id": "16954198", "url": "https://glygen.org/publication/PubMed/16954198" } ] }, { "title": "Novel regulation of CCL2 gene expression by murine LITAF and STAT6B.", "journal": "PLoS ONE", "date": "2011", "authors": "Yang Y., Tang X., Amar S.", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "reference": [ { "type": "PubMed", "id": "21980379", "url": "https://glygen.org/publication/PubMed/21980379" } ] }, { "title": "Whole-body deletion of LPS-induced TNF-alpha factor (LITAF) markedly improves experimental endotoxic shock and inflammatory arthritis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2011", "authors": "You J., Amar S., Leeman S.E., Constable C., Merrill J.C.", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "reference": [ { "type": "PubMed", "id": "22160695", "url": "https://glygen.org/publication/PubMed/22160695" } ] }, { "title": "LITAF (SIMPLE) regulates Wallerian degeneration after injury but is not essential for peripheral nerve development and maintenance: implications for Charcot-Marie-Tooth disease.", "journal": "Glia", "date": "2012", "authors": "Horn M., Suter U., Gerber D., Pereira J.A., Somandin C.", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "reference": [ { "type": "PubMed", "id": "22729949", "url": "https://glygen.org/publication/PubMed/22729949" } ] }, { "title": "Charcot-Marie-Tooth disease-linked protein SIMPLE functions with the ESCRT machinery in endosomal trafficking.", "journal": "J. Cell Biol.", "date": "2012", "authors": "Lee SM, Chin LS, Li L", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "reference": [ { "type": "PubMed", "id": "23166352", "url": "https://glygen.org/publication/PubMed/23166352" } ] }, { "title": "SIMPLE binds specifically to PI4P through SIMPLE-like domain and participates in protein trafficking in the trans-Golgi network and/or recycling endosomes.", "journal": "PloS one", "date": "2018", "authors": "Moriwaki Y, Ohno Y, Ishii T, Takamura Y, Kita Y, Watabe K, Sango K, Tsuji S, Misawa H", "evidence": [ { "database": "RefSeq", "id": "NP_064364", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364" } ], "reference": [ { "type": "PubMed", "id": "29953492", "url": "https://glygen.org/publication/PubMed/29953492" } ] }, { "title": "Sequential CRISPR-Based Screens Identify LITAF and CDIP1 as the Bacillus cereus Hemolysin BL Toxin Host Receptors.", "journal": "Cell host & microbe", "date": "2020", "authors": "Liu J, Zuo Z, Sastalla I, Liu C, Jang JY, Sekine Y, Li Y, Pirooznia M, Leppla SH, Finkel T, Liu S", "evidence": [ { "database": "RefSeq", "id": "NP_064364", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364" } ], "reference": [ { "type": "PubMed", "id": "32544461", "url": "https://glygen.org/publication/PubMed/32544461" } ] }, { "title": "LITAF acts as a novel regulator for pathological cardiac hypertrophy.", "journal": "Journal of molecular and cellular cardiology", "date": "2021", "authors": "Xiang M, Yang F, Zhou Y, Li W, Zou Y, Ye P, Zhu L, Wang PX, Chen M", "evidence": [ { "database": "RefSeq", "id": "NP_064364", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364" } ], "reference": [ { "type": "PubMed", "id": "33823186", "url": "https://glygen.org/publication/PubMed/33823186" } ] }, { "title": "SIMPLE Is an Endosomal Regulator That Protects Against NAFLD by Targeting the Lysosomal Degradation of EGFR.", "journal": "Hepatology (Baltimore, Md.)", "date": "2021", "authors": "Song J, Liu Y, Wan J, Zhao GN, Wang JC, Dai Z, Hu S, Yang L, Liu Z, Fu Y, Dong E, Tang YD", "evidence": [ { "database": "RefSeq", "id": "NP_064364", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064364" } ], "reference": [ { "type": "PubMed", "id": "34320238", "url": "https://glygen.org/publication/PubMed/34320238" } ] } ], "pathway": [ { "id": "mmu:56722", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56722", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P0C0T0-1", "protein_name": "Lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog", "gene_name": "Litaf", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSAPGPYQAAAGPSVMPTAPPTYEETVGVNSYYPTPPAPQPGPATGLITGPDGKGMNPPSYYTQPVPVPNANAIAVQTVYVQQPISFYDRPIQMCCPSCNKMIVTQLSYNAGALTWLSCGSLCLLGCVAGCCFIPFCVDALQDVDHYCPNCKALLGTYKRL", "length": 161 }, "evidence": [ { "id": "45236253", "url": "http://www.informatics.jax.org/homology/45236253", "database": "MGI" }, { "id": "Q9JLJ0", "url": "https://omabrowser.org/oma/group/Q9JLJ0/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q99732-1", "protein_name": "Lipopolysaccharide-induced tumor necrosis factor-alpha factor", "gene_name": "LITAF", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL", "length": 161 }, "evidence": [ { "id": "45236253", "url": "http://www.informatics.jax.org/homology/45236253", "database": "MGI" }, { "id": "Q9JLJ0", "url": "https://omabrowser.org/oma/group/Q9JLJ0/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 11, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "cytoplasmic side of plasma membrane", "id": "GO:0009898", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009898", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "cytoplasmic side of lysosomal membrane", "id": "GO:0098574", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098574", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "cytoplasmic side of late endosome membrane", "id": "GO:0098560", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098560", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "cytoplasmic side of early endosome membrane", "id": "GO:0098559", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098559", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "WW domain binding", "id": "GO:0050699", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050699", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "response to lipopolysaccharide", "id": "GO:0032496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032496", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "cellular response to lipopolysaccharide", "id": "GO:0071222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071222", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "positive regulation of I-kappaB kinase/NF-kappaB signaling", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "negative regulation of NIK/NF-kappaB signaling", "id": "GO:1901223", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901223", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "regulation of cytokine production", "id": "GO:0001817", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001817", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" }, { "name": "regulation of macrophage cytokine production", "id": "GO:0010935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010935", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylated on tyrosine residues in response to EGF.", "evidence": [ { "database": "UniProtKB", "id": "Q9JLJ0", "url": "https://www.uniprot.org/uniprot/Q9JLJ0" }, { "database": "PubMed", "id": "Q99732", "url": "https://glygen.org/publication/PubMed/Q99732" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }