{ "uniprot_canonical_ac": "Q9JLB0-1", "uniprot_ac": "Q9JLB0", "uniprot_id": "PALS2_MOUSE", "mass": { "chemical_mass": 62631.0, "monoisotopic_mass": 62631.0 }, "refseq": { "ac": "NP_001158205", "name": "protein PALS2 isoform a", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205" }, "gene_names": [ { "name": "Pals2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9JLB0", "id": "Q9JLB0" }, { "name": "Dlgh4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9JLB0", "id": "Q9JLB0" }, { "name": "Mpp6; P55t", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205", "id": "NP_001158205" }, { "name": "Mpp6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9JLB0", "id": "Q9JLB0" }, { "name": "Pals2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205", "id": "NP_001158205" } ], "protein_names": [ { "name": "Protein PALS2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9JLB0" }, { "name": "Dlgh4 protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JLB0" }, { "name": "MAGUK p55 subfamily member 6; dlgh4 protein; protein associated with Lin-7 2; membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 6); fibroblast growth factor-inducible protein 15; membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6); protein PALS2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205", "id": "NP_001158205" }, { "name": "MAGUK p55 subfamily member 6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JLB0" }, { "name": "P55T protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JLB0" }, { "name": "Protein associated with Lin-7 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JLB0" }, { "name": "protein PALS2 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205", "id": "NP_001158205" } ], "function": [ { "annotation": "In the mouse sciatic nerve, protein 4.1G colocalized at Schmidt-Lanterman incisures (SLI) and the paranodes with a member of the membrane-associated guanylate kinase (MAGUK) family, membrane protein palmitoylated 6.", "evidence": [ { "database": "RefSeq", "id": "NP_001158205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205" }, { "database": "PubMed", "id": "22025680", "url": "https://glygen.org/publication/PubMed/22025680" } ] }, { "annotation": "The findings indicate that the Src-MPP6-4.1G protein complex in Schmidt-Lanterman incisures(SLIs) has a role in signal transduction in the peripheral nervous system(PNS).", "evidence": [ { "database": "RefSeq", "id": "NP_001158205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205" }, { "database": "PubMed", "id": "23306908", "url": "https://glygen.org/publication/PubMed/23306908" } ] }, { "annotation": "The results indicate that the MPP6-Lin7 complex regulates myelin formation.", "evidence": [ { "database": "RefSeq", "id": "NP_001158205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205" }, { "database": "PubMed", "id": "30357511", "url": "https://glygen.org/publication/PubMed/30357511" } ] }, { "annotation": "This paper herein showed the immunolocalization and interaction proteins of MPP6 in the mouse small intestine, and also that 4.1B in epithelial cells was not essential for the sorting of MPP6.", "evidence": [ { "database": "RefSeq", "id": "NP_001158205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205" }, { "database": "PubMed", "id": "26496923", "url": "https://glygen.org/publication/PubMed/26496923" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9JLB0", "url": "https://www.uniprot.org/uniprot/Q9JLB0" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Pals2", "url": "https://www.uniprot.org/uniprot/Q9JLB0", "locus": { "chromosome": "6", "start_pos": 50175919, "end_pos": 50087221, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000038388", "url": "https://www.ensembl.org/id/ENSMUSG00000038388" } ] } } ], "crossref": [ { "id": "ENSMUSG00000038388", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000038388", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00071", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00071", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00992", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00992", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12038", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12038", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "56524", "url": "https://www.ncbi.nlm.nih.gov/gene/56524", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "E9Q2R8", "url": "https://www.ebi.ac.uk/intact/interactors/id:E9Q2R8*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "Q9JLB0", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9JLB0*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001478", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001478", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004172", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004172", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008144", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008144", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008145", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008145", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014775", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014775", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020590", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020590", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035603", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035603", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036028", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036028", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036034", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036034", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036892", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036892", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:56524", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56524", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1927340", "url": "http://www.informatics.jax.org/marker/MGI:1927340", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "FRYPHFR", "url": "https://omabrowser.org/oma/group/FRYPHFR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2873706at2759", "url": "http://www.orthodb.org/?query=2873706at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23122", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23122", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23122:SF45", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23122:SF45", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00595", "url": "http://pfam.xfam.org/family/PF00595", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00625", "url": "http://pfam.xfam.org/family/PF00625", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF02828", "url": "http://pfam.xfam.org/family/PF02828", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF07653", "url": "http://pfam.xfam.org/family/PF07653", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9JLB0", "url": "http://purl.obolibrary.org/obo/PR_Q9JLB0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001158205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "E9PWC5", "url": "https://www.uniprot.org/uniprot/E9PWC5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PWC5-1", "url": "https://www.uniprot.org/uniprot/E9PWC5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q2R8", "url": "https://www.uniprot.org/uniprot/E9Q2R8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9Q2R8-1", "url": "https://www.uniprot.org/uniprot/E9Q2R8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JLB0", "url": "https://www.uniprot.org/uniprot/Q9JLB0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JLB0-1", "url": "https://www.uniprot.org/uniprot/Q9JLB0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JLB0-2", "url": "https://www.uniprot.org/uniprot/Q9JLB0-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNIPSLNNQLPVDAIRILGIHKKAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQSYVNMERHPAHVRQVFVKCHFDYNPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISNKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPARFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFEKLQTAIEKLRMEPQWVPISWVY", "length": 553, "header": "sp|Q9JLB0-1|PALS2_MOUSE Isoform 1 of Protein PALS2 OS=Mus musculus OX=10090 GN=Pals2 PE=1 SV=1 CANONICAL=Q9JLB0-1" }, "isoforms": [ { "isoform_ac": "E9PWC5-1", "url": "", "sequence": { "sequence": "MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNIPSLNNQLPVDAIRILGIHKKAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQSYVNMERHPAHVRQVFVKCHFDYNPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTIS", "length": 315, "header": "tr|E9PWC5-1|PALS2_MOUSE Computationally mapped isoform of Protein PALS2 OS=Mus musculus OX=10090 GN=Pals2 PE=1 SV=1 CANONICAL=Q9JLB0-1" }, "locus": { "chromosome": "6", "start_pos": 50157593, "end_pos": 50122756, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000167628.2", "url": "https://www.ensembl.org/id/ENSMUST00000167628.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000129355.2", "url": "https://www.ensembl.org/id/ENSMUSP00000129355.2" } ] } }, { "isoform_ac": "E9Q2R8-1", "url": "", "sequence": { "sequence": "MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAYLLEKVWC", "length": 48, "header": "tr|E9Q2R8-1|E9Q2R8_MOUSE Computationally mapped isoform of Protein associated with LIN7 2, MAGUK family member OS=Mus musculus OX=10090 GN=Pals2 PE=1 SV=1 CANONICAL=Q9JLB0-1" }, "locus": { "chromosome": "6", "start_pos": 50128945, "end_pos": 50122756, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000171601.8", "url": "https://www.ensembl.org/id/ENSMUST00000171601.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000129004.2", "url": "https://www.ensembl.org/id/ENSMUSP00000129004.2" } ] } }, { "isoform_ac": "Q9JLB0-1", "url": "", "sequence": { "sequence": "MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNIPSLNNQLPVDAIRILGIHKKAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQSYVNMERHPAHVRQVFVKCHFDYNPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISNKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPARFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFEKLQTAIEKLRMEPQWVPISWVY", "length": 553, "header": "sp|Q9JLB0-1|PALS2_MOUSE Isoform 1 of Protein PALS2 OS=Mus musculus OX=10090 GN=Pals2 PE=1 SV=1 CANONICAL=Q9JLB0-1" }, "locus": { "chromosome": "6", "start_pos": 50175307, "end_pos": 50122756, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000036225", "url": "https://www.ensembl.org/id/ENSMUST00000036225" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000038772", "url": "https://www.ensembl.org/id/ENSMUSP00000038772" } ] } }, { "isoform_ac": "Q9JLB0-2", "url": "", "sequence": { "sequence": "MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNIPSLNNQLPVDAIRILGIHKKAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQVFVKCHFDYNPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISNKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPARFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFEKLQTAIEKLRMEPQWVPISWVY", "length": 539, "header": "sp|Q9JLB0-2|PALS2_MOUSE Isoform 2 of Protein PALS2 OS=Mus musculus OX=10090 GN=Pals2 PE=1 SV=1 CANONICAL=Q9JLB0-1" }, "locus": { "chromosome": "6", "start_pos": 50175307, "end_pos": 50122756, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000036236", "url": "https://www.ensembl.org/id/ENSMUST00000036236" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000039314", "url": "https://www.ensembl.org/id/ENSMUSP00000039314" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 513, "end_pos": 513, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9JLB0", "url": "https://www.uniprot.org/uniprot/Q9JLB0" } ], "site_lbl": "Tyr513" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Molecular cloning and characterization of Pals, proteins associated with mLin-7.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Kamberov E, Makarova O, Roh M, Liu A, Karnak D, Straight S, Margolis B", "evidence": [ { "database": "UniProtKB", "id": "Q9JLB0", "url": "https://www.uniprot.org/uniprot/Q9JLB0" } ], "reference": [ { "type": "PubMed", "id": "10753959", "url": "https://glygen.org/publication/PubMed/10753959" } ] }, { "title": "Implications of nectin-like molecule-2/IGSF4/RA175/SgIGSF/TSLC1/SynCAM1 in cell-cell adhesion and transmembrane protein localization in epithelial cells.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Satoh K., Takai Y., Monden M., Itoh S., Imai T., Takeuchi M., Morimoto K., Ikeda W., Kakunaga S., Shingai T., Takekuni K.", "evidence": [ { "database": "UniProtKB", "id": "Q9JLB0", "url": "https://www.uniprot.org/uniprot/Q9JLB0" } ], "reference": [ { "type": "PubMed", "id": "12826663", "url": "https://glygen.org/publication/PubMed/12826663" } ] }, { "title": "Essential function of protein 4.1G in targeting of membrane protein palmitoylated 6 into Schmidt-Lanterman incisures in myelinated nerves.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Terada N, Saitoh Y, Ohno N, Komada M, Saitoh S, Peles E, Ohno S", "evidence": [ { "database": "RefSeq", "id": "NP_001158205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205" } ], "reference": [ { "type": "PubMed", "id": "22025680", "url": "https://glygen.org/publication/PubMed/22025680" } ] }, { "title": "Involvement of Src in the membrane skeletal complex, MPP6-4.1G, in Schmidt-Lanterman incisures of mouse myelinated nerve fibers in PNS.", "journal": "Histochemistry and cell biology", "date": "2013", "authors": "Terada N, Saitoh Y, Ohno N, Komada M, Yamauchi J, Ohno S", "evidence": [ { "database": "RefSeq", "id": "NP_001158205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205" } ], "reference": [ { "type": "PubMed", "id": "23306908", "url": "https://glygen.org/publication/PubMed/23306908" } ] }, { "title": "Immunohistochemical study of the membrane skeletal protein, membrane protein palmitoylated 6 (MPP6), in the mouse small intestine.", "journal": "Histochemistry and cell biology", "date": "2016", "authors": "Kamijo A, Saitoh Y, Ohno N, Ohno S, Terada N", "evidence": [ { "database": "RefSeq", "id": "NP_001158205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205" } ], "reference": [ { "type": "PubMed", "id": "26496923", "url": "https://glygen.org/publication/PubMed/26496923" } ] }, { "title": "The membrane palmitoylated protein, MPP6, is involved in myelin formation in the mouse peripheral nervous system.", "journal": "Histochemistry and cell biology", "date": "2019", "authors": "Saitoh Y, Kamijo A, Yamauchi J, Sakamoto T, Terada N", "evidence": [ { "database": "RefSeq", "id": "NP_001158205", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001158205" } ], "reference": [ { "type": "PubMed", "id": "30357511", "url": "https://glygen.org/publication/PubMed/30357511" } ] } ], "pathway": [ { "id": "mmu:56524", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56524", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "B5DFE0-1", "protein_name": "Membrane palmitoylated protein 6", "gene_name": "Pals2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCYESPPSSPEMNIPSLNNQLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTIAPQQVFVKCHFDYNPFNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISNKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPARFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIGSILDVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIVNDNLDKAFENLQTAIEKLRTEPQWVPISWVY", "length": 540 }, "evidence": [ { "id": "45228887", "url": "http://www.informatics.jax.org/homology/45228887", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9NZW5-1", "protein_name": "Protein PALS2", "gene_name": "PALS2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNNSSINNQLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQVFVKCHFDYNPYNDNLIPCKEAGLKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGTISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKLLTDSDLKKTVDESARIQRAYNHYFDLIIINDNLDKAFEKLQTAIEKLRMEPQWVPISWVY", "length": 540 }, "evidence": [ { "id": "45228887", "url": "http://www.informatics.jax.org/homology/45228887", "database": "MGI" }, { "id": "Q9JLB0", "url": "https://omabrowser.org/oma/group/Q9JLB0/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "guanylate kinase activity", "id": "GO:0004385", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004385", "evidence": [ { "database": "UniProtKB", "id": "Q9JLB0", "url": "https://www.uniprot.org/uniprot/Q9JLB0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9JLB0", "url": "https://www.uniprot.org/uniprot/Q9JLB0" } ], "pmid": "" }, { "name": "cell-cell junction", "id": "GO:0005911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005911", "evidence": [ { "database": "UniProtKB", "id": "Q9JLB0", "url": "https://www.uniprot.org/uniprot/Q9JLB0" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9JLB0", "url": "https://www.uniprot.org/uniprot/Q9JLB0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 195, "end_pos": 197, "annotation": "n_glycosylation_sequon" }, { "start_pos": 7, "end_pos": 9, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }