{ "uniprot_canonical_ac": "Q9JL62-1", "uniprot_ac": "Q9JL62", "uniprot_id": "GLTP_MOUSE", "mass": { "chemical_mass": 23690.0, "monoisotopic_mass": 23690.0 }, "refseq": { "ac": "NP_062795", "name": "glycolipid transfer protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062795" }, "gene_names": [ { "name": "Gltp", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9JL62", "id": "Q9JL62" }, { "name": "1110001F24Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062795", "id": "NP_062795" }, { "name": "Gltp", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062795", "id": "NP_062795" } ], "protein_names": [ { "name": "Glycolipid transfer protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9JL62" }, { "name": "GLTP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JL62" }, { "name": "glycolipid transfer protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062795", "id": "NP_062795" } ], "function": [ { "annotation": "Accelerates the intermembrane transfer of various glycolipids. Catalyzes the transfer of various glycosphingolipids between membranes but does not catalyze the transfer of phospholipids. May be involved in the intracellular translocation of glucosylceramides (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gltp", "url": "https://www.uniprot.org/uniprot/Q9JL62", "locus": { "chromosome": "5", "start_pos": 114807459, "end_pos": 114829045, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000011884", "url": "https://www.ensembl.org/id/ENSMUSG00000011884" } ] } } ], "crossref": [ { "id": "ENSMUSG00000011884", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000011884", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "56356", "url": "https://www.ncbi.nlm.nih.gov/gene/56356", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9JL62", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9JL62*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR014830", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014830", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036497", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036497", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:56356", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56356", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1929253", "url": "http://www.informatics.jax.org/marker/MGI:1929253", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "EMHGAEW", "url": "https://omabrowser.org/oma/group/EMHGAEW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "509274at2759", "url": "http://www.orthodb.org/?query=509274at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10219", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10219", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10219:SF97", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10219:SF97", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08718", "url": "http://pfam.xfam.org/family/PF08718", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9JL62", "url": "http://purl.obolibrary.org/obo/PR_Q9JL62", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-9840309", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9840309", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_062795", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062795", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "D3Z1H8", "url": "https://www.uniprot.org/uniprot/D3Z1H8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z1H8-1", "url": "https://www.uniprot.org/uniprot/D3Z1H8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z1H9", "url": "https://www.uniprot.org/uniprot/D3Z1H9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3Z1H9-1", "url": "https://www.uniprot.org/uniprot/D3Z1H9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JL62-1", "url": "https://www.uniprot.org/uniprot/Q9JL62-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALLAEHLLKPLPADRQIETGPFLEAVAHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTDPAKFKTLQNILEVEKGMYGAEWPKVGATLALLWLKRGLRFIQVFLQSICDGERDENHPNLIRVNANKAYEMALKKYHGWLVQKIFKAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDAIYDMYTKMNAELDYTV", "length": 209, "header": "sp|Q9JL62-1|GLTP_MOUSE Isoform 1 of Glycolipid transfer protein OS=Mus musculus OX=10090 GN=Gltp PE=1 SV=3 CANONICAL=Q9JL62-1" }, "isoforms": [ { "isoform_ac": "D3Z1H8-1", "url": "", "sequence": { "sequence": "MALLAEHLLKPLPADRQIETGPFLEAVAHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTDPAKFKTLQNILEVFLQSICDGERDENHPNLIRVNANKAYEMALKKYHGWLVQKIFKAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDAIYDMYTKMNAELDYTV", "length": 179, "header": "tr|D3Z1H8-1|GLTP_MOUSE Computationally mapped isoform of Glycolipid transfer protein OS=Mus musculus OX=10090 GN=Gltp PE=1 SV=1 CANONICAL=Q9JL62-1" }, "locus": { "chromosome": "5", "start_pos": 114828922, "end_pos": 114808471, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000112214.8", "url": "https://www.ensembl.org/id/ENSMUST00000112214.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000107833.2", "url": "https://www.ensembl.org/id/ENSMUSP00000107833.2" } ] } }, { "isoform_ac": "D3Z1H9-1", "url": "", "sequence": { "sequence": "MALLAEHLLKPLPADRQIETGPFLEAVAHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTDPAKFKTLQNILEVEKGMGLRFIQVFLQSICDGERDENHPNLIRVNANKAYEMALKKYHGWLVQKIFKAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDAIYDMYTKMNAELDYTV", "length": 190, "header": "tr|D3Z1H9-1|GLTP_MOUSE Computationally mapped isoform of Glycolipid transfer protein OS=Mus musculus OX=10090 GN=Gltp PE=1 SV=1 CANONICAL=Q9JL62-1" }, "locus": { "chromosome": "5", "start_pos": 114828922, "end_pos": 114808471, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000112212.2", "url": "https://www.ensembl.org/id/ENSMUST00000112212.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000107831.2", "url": "https://www.ensembl.org/id/ENSMUSP00000107831.2" } ] } }, { "isoform_ac": "Q9JL62-1", "url": "", "sequence": { "sequence": "MALLAEHLLKPLPADRQIETGPFLEAVAHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTDPAKFKTLQNILEVEKGMYGAEWPKVGATLALLWLKRGLRFIQVFLQSICDGERDENHPNLIRVNANKAYEMALKKYHGWLVQKIFKAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDAIYDMYTKMNAELDYTV", "length": 209, "header": "sp|Q9JL62-1|GLTP_MOUSE Isoform 1 of Glycolipid transfer protein OS=Mus musculus OX=10090 GN=Gltp PE=1 SV=3 CANONICAL=Q9JL62-1" }, "locus": { "chromosome": "5", "start_pos": 114828922, "end_pos": 114808471, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000012028", "url": "https://www.ensembl.org/id/ENSMUST00000012028" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000012028", "url": "https://www.ensembl.org/id/ENSMUSP00000012028" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:56356", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:56356", "resource": "KEGG Pathway" }, { "id": "R-MMU-9840309", "name": "Glycosphingolipid biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9840309", "resource": "Reactome", "description": "Glycosphingolipid biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "B0BNM9-1", "protein_name": "Glycolipid transfer protein", "gene_name": "GLTP", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MALLAEHLLKPLPADRQIETGPFLEAVAHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTDPAKFKTLQNILEVEKGMYGAEWPKVGATLALLWLKRGLRFIQVFLQSICDGERDENHPNLIRVNANKAYEMALKKYHGWLVQKIFKAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDAIYEMYTKMNAELDYTV", "length": 209 }, "evidence": [ { "id": "45234059", "url": "http://www.informatics.jax.org/homology/45234059", "database": "MGI" }, { "id": "Q9JL62", "url": "https://omabrowser.org/oma/group/Q9JL62/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9NZD2-1", "protein_name": "Glycolipid transfer protein", "gene_name": "GLTP", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALLAEHLLKPLPADKQIETGPFLEAVSHLPPFFDCLGSPVFTPIKADISGNITKIKAVYDTNPAKFRTLQNILEVEKEMYGAEWPKVGATLALMWLKRGLRFIQVFLQSICDGERDENHPNLIRVNATKAYEMALKKYHGWIVQKIFQAALYAAPYKSDFLKALSKGQNVTEEECLEKIRLFLVNYTATIDVIYEMYTQMNAELNYKV", "length": 209 }, "evidence": [ { "id": "45234059", "url": "http://www.informatics.jax.org/homology/45234059", "database": "MGI" }, { "id": "Q9JL62", "url": "https://omabrowser.org/oma/group/Q9JL62/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "lipid transfer activity", "id": "GO:0120013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120013", "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62" } ], "pmid": "" }, { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62" } ], "pmid": "" }, { "name": "ceramide 1-phosphate binding", "id": "GO:1902387", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902387", "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62" } ], "pmid": "" }, { "name": "ceramide 1-phosphate transfer activity", "id": "GO:1902388", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902388", "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62" } ], "pmid": "" }, { "name": "glycolipid binding", "id": "GO:0051861", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051861", "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "ER to Golgi ceramide transport", "id": "GO:0035621", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035621", "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62" } ], "pmid": "" }, { "name": "intermembrane lipid transfer", "id": "GO:0120009", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120009", "evidence": [ { "database": "UniProtKB", "id": "Q9JL62", "url": "https://www.uniprot.org/uniprot/Q9JL62" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 170, "end_pos": 172, "annotation": "n_glycosylation_sequon" }, { "start_pos": 186, "end_pos": 188, "annotation": "n_glycosylation_sequon" }, { "start_pos": 52, "end_pos": 54, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }