{ "uniprot_canonical_ac": "Q9JJ05-1", "uniprot_ac": "Q9JJ05", "uniprot_id": "C1GLT_RAT", "mass": { "chemical_mass": 42311.0, "monoisotopic_mass": 42311.0 }, "refseq": { "ac": "NP_075239", "name": "glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075239" }, "gene_names": [ { "name": "C1galt1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9JJ05", "id": "Q9JJ05" }, { "name": "C1galt1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075239", "id": "NP_075239" } ], "protein_names": [ { "name": "Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9JJ05" }, { "name": "2.4.1.122", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JJ05" }, { "name": "C1GalT1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JJ05" }, { "name": "Core 1 O-glycan T-synthase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JJ05" }, { "name": "Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JJ05" }, { "name": "Core 1 beta1,3-galactosyltransferase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JJ05" }, { "name": "Core 1 beta3-Gal-T1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JJ05" }, { "name": "glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075239", "id": "NP_075239" }, { "name": "glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1; core 1 beta3-Gal-T; core 1 O-glycan T-synthase; core 1 beta1,3-galactosyltransferase 1; core1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1; core 1 beta3-Gal-T1; core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1; core1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase (C1galt1); core1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 13-galactosyltransferase (C1galt1)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075239", "id": "NP_075239" } ], "function": [ { "annotation": "Glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins.", "evidence": [ { "database": "UniProtKB", "id": "A0A8L2Q5I0", "url": "https://www.uniprot.org/uniprot/A0A8L2Q5I0#function" }, { "database": "UniProtKB", "id": "RU364049", "url": "https://www.uniprot.org/uniprot/RU364049#function" }, { "database": "UniProtKB", "id": "A0A8I5ZNI5", "url": "https://www.uniprot.org/uniprot/A0A8I5ZNI5#function" }, { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05#function" }, { "database": "PubMed", "id": "11673471", "url": "https://glygen.org/publication/PubMed/11673471" } ] } ], "disease": [ { "disease_id": "DOID:0060050", "recommended_name": { "id": "DOID:0060050", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060050", "name": "autoimmune disease of blood", "description": "An autoimmune disease that is the abnormal functioning of the immune system that causes your immune system to produce antibodies or T cells against cells and/or tissues in the blood." }, "synonyms": [], "evidence": [ { "id": "0060050", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060050" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "common_name": "Rat" } ], "gene": [ { "name": "C1galt1", "url": "https://www.uniprot.org/uniprot/Q9JJ05", "locus": { "chromosome": "4", "start_pos": 35961831, "end_pos": 35928104, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000007804", "url": "https://www.ensembl.org/id/ENSRNOG00000007804" } ] } } ], "crossref": [ { "id": "ENSRNOG00000007804", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000007804", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.4.1.122", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.122&UniProtAcc=Q9JJ05", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "GT31", "url": "http://www.cazy.org/GT31.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "65044", "url": "https://www.ncbi.nlm.nih.gov/gene/65044", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003378", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003378", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:65044", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:65044", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "WLLSKHD", "url": "https://omabrowser.org/oma/group/WLLSKHD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "360875at2759", "url": "http://www.orthodb.org/?query=360875at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23033", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23033", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23033:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23033:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02434", "url": "http://pfam.xfam.org/family/PF02434", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9JJ05", "url": "http://purl.obolibrary.org/obo/PR_Q9JJ05", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-913709", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-913709", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_075239", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_075239", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "621105", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=621105", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "15621", "url": "https://www.rhea-db.org/rhea/15621", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A8I5ZNI5", "url": "https://www.uniprot.org/uniprot/A0A8I5ZNI5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZNI5-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZNI5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q5I0", "url": "https://www.uniprot.org/uniprot/A0A8L2Q5I0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2Q5I0-1", "url": "https://www.uniprot.org/uniprot/A0A8L2Q5I0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JJ05-1", "url": "https://www.uniprot.org/uniprot/Q9JJ05-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASKSWLNFLTFLCGSAIGFFLCSQLLNILLQEQADVQPNMLHNDPHARHSDDSGHNHLKGQMDFNADSSQHKDENTDVAENLYQKVKVLCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPTVGLETKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVDAFKTEKCTHSSSIEDLALGRCMEIIKVEAGDSRDPTGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPVEGPGCCSDIAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPALPENILKEINQVNKKEDTKIKLGNP", "length": 363, "header": "sp|Q9JJ05-1|C1GLT_RAT Isoform 1 of Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1 CANONICAL=Q9JJ05-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZNI5-1", "url": "", "sequence": { "sequence": "MKVTDMSIISTSKEITARLYKEIHSQEMASKSWLNFLTFLCGSAIGFFLCSQLLNILLQEQADVQPNMLHNDPHARHSDDSGHNHLKGQMDFNADSSQHKDENTDVAENLYQKVKVLCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPTVGLETKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVDAFKTEKCTHSSSIEDLALGRCMEIIKVEAGDSRDPTGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPVEGPGCCSDIAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPALPENILKEINQVNKKEDTKIKLGNP", "length": 390, "header": "tr|A0A8I5ZNI5-1|C1GLT_RAT Computationally mapped isoform of Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1 CANONICAL=Q9JJ05-1" }, "locus": { "chromosome": "4", "start_pos": 35961599, "end_pos": 35928715, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000112848.1", "url": "https://www.ensembl.org/id/ENSRNOT00000112848.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000079450.1", "url": "https://www.ensembl.org/id/ENSRNOP00000079450.1" } ] } }, { "isoform_ac": "A0A8L2Q5I0-1", "url": "", "sequence": { "sequence": "MSEIHSQEMASKSWLNFLTFLCGSAIGFFLCSQLLNILLQEQADVQPNMLHNDPHARHSDDSGHNHLKGQMDFNADSSQHKDENTDVAENLYQKVKVLCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPTVGLETKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVDAFKTEKCTHSSSIEDLALGRCMEIIKVEAGDSRDPTGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPVEGPGCCSDIAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPALPENILKEINQVNKKEDTKIKLGNP", "length": 371, "header": "tr|A0A8L2Q5I0-1|C1GLT_RAT Computationally mapped isoform of Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1 CANONICAL=Q9JJ05-1" }, "locus": { "chromosome": "4", "start_pos": 35961599, "end_pos": 35931130, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000010375.3", "url": "https://www.ensembl.org/id/ENSRNOT00000010375.3" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000010375.2", "url": "https://www.ensembl.org/id/ENSRNOP00000010375.2" } ] } }, { "isoform_ac": "Q9JJ05-1", "url": "", "sequence": { "sequence": "MASKSWLNFLTFLCGSAIGFFLCSQLLNILLQEQADVQPNMLHNDPHARHSDDSGHNHLKGQMDFNADSSQHKDENTDVAENLYQKVKVLCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPTVGLETKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVDAFKTEKCTHSSSIEDLALGRCMEIIKVEAGDSRDPTGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPVEGPGCCSDIAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPALPENILKEINQVNKKEDTKIKLGNP", "length": 363, "header": "sp|Q9JJ05-1|C1GLT_RAT Isoform 1 of Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1 CANONICAL=Q9JJ05-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 235, "end_pos": 235, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "site_lbl": "Ser235" } ], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity" ], "publication": [ { "title": "Purification, characterization, and subunit structure of rat core 1 Beta1,3-galactosyltransferase.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Canfield W.M., Cummings R.D., Ju T.", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "reference": [ { "type": "PubMed", "id": "11673471", "url": "https://glygen.org/publication/PubMed/11673471" } ] }, { "title": "Cloning and expression of human core 1 beta1,3-galactosyltransferase.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Ju T, Brewer K, D'Souza A, Cummings RD, Canfield WM", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "reference": [ { "type": "PubMed", "id": "11677243", "url": "https://glygen.org/publication/PubMed/11677243" } ] } ], "pathway": [ { "id": "rno:65044", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:65044", "resource": "KEGG Pathway" }, { "id": "R-RNO-913709", "name": "O-linked glycosylation of mucins", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-913709", "resource": "Reactome", "description": "O-linked glycosylation of mucins" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9JJ06-1", "protein_name": "Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1", "gene_name": "C1galt1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASKSWLNFLVFLCGSAIGFFLCSQLLSILLREEAAIQPNMLHNDPHARHSDDNGHSHLKGQMNFNADSSQHKDENIDVAENLYQKVKILCWVMTSPQNLEKKAKHVKATWAQRCNKVLFMSSEENQDFPTVGLKTKEGREQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVIVDNLRWLLSKYNPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALRRFVNAFKTEKCTHSSSIEDLALGRCMEIINVEAGDSRDTIGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPIEGPGCCSDIAVSFHYVDGTTMYELEYLVYHLRPYGYLYRYQPALPENILKEINQVNRKEDTKIKLGNP", "length": 363 }, "evidence": [ { "id": "45236651", "url": "http://www.informatics.jax.org/homology/45236651", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NS00-1", "protein_name": "Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1", "gene_name": "C1GALT1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP", "length": 363 }, "evidence": [ { "id": "45236651", "url": "http://www.informatics.jax.org/homology/45236651", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "protein glycosylation", "id": "GO:0006486", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006486", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "pmid": "" }, { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "pmid": "" }, { "name": "kidney development", "id": "GO:0001822", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001822", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "pmid": "" }, { "name": "protein O-linked glycosylation", "id": "GO:0006493", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006493", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "pmid": "" }, { "name": "O-glycan processing, core 1", "id": "GO:0016267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016267", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "pmid": "" }, { "name": "intestinal epithelial cell development", "id": "GO:0060576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060576", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "pmid": "" }, { "name": "glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase activity", "id": "GO:0016263", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016263", "evidence": [ { "database": "UniProtKB", "id": "Q9JJ05", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "15621", "name": "", "equation": "an N-acetyl-alpha-D-galactosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9JJ05-1", "Q9NS00-1", "Q9JJ06-1", "Q7K237-1" ], "evidence": [ { "id": "15621", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/15621" } ] }, { "id": "R-RNO-1964505", "name": "C1GALT1 transfers Galactose to the Tn antigen forming Core 1 glycoproteins (T antigens)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9JJ05-1" ], "evidence": [ { "id": "R-RNO-1964505", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-1964505" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "Q7K237", "gene_name": "C1GalTA", "activity": [ { "ec_number": "2.4.1.122", "activity": "an N-acetyl-alpha-D-galactosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q7K237", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K237" } ] }, { "ec_number": "2.4.1.122", "activity": "", "evidence": [ { "id": "Q7K237", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7K237" } ] } ] }, { "uniprot_ac": "Q9JJ05", "gene_name": "C1galt1", "activity": [ { "ec_number": "2.4.1.122", "activity": "an N-acetyl-alpha-D-galactosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q9JJ05", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ] }, { "ec_number": "2.4.1.122", "activity": "", "evidence": [ { "id": "Q9JJ05", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ05" } ] } ] }, { "uniprot_ac": "Q9JJ06", "gene_name": "C1galt1", "activity": [ { "ec_number": "2.4.1.122", "activity": "an N-acetyl-alpha-D-galactosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q9JJ06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ06" } ] }, { "ec_number": "2.4.1.122", "activity": "", "evidence": [ { "id": "Q9JJ06", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ06" } ] } ] }, { "uniprot_ac": "Q9NS00", "gene_name": "C1GALT1", "activity": [ { "ec_number": "2.4.1.122", "activity": "an N-acetyl-alpha-D-galactosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->3)-N-acetyl-alpha-D-galactosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q9NS00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NS00" } ] }, { "ec_number": "2.4.1.122", "activity": "", "evidence": [ { "id": "Q9NS00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NS00" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }