{ "uniprot_canonical_ac": "Q9JIP4-1", "uniprot_ac": "Q9JIP4", "uniprot_id": "PANX1_MOUSE", "mass": { "chemical_mass": 48167.0, "monoisotopic_mass": 48167.0 }, "refseq": { "ac": "NP_062355", "name": "pannexin-1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" }, "gene_names": [ { "name": "Panx1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9JIP4", "id": "Q9JIP4" }, { "name": "Panx1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355", "id": "NP_062355" } ], "protein_names": [ { "name": "Pannexin-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9JIP4" }, { "name": "pannexin-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355", "id": "NP_062355" } ], "function": [ { "annotation": "Astrocyte and Neuronal Panx1 Support Long-Term Reference Memory in Mice.", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" }, { "database": "PubMed", "id": "37365910", "url": "https://glygen.org/publication/PubMed/37365910" } ] }, { "annotation": "Blocking Pannexin-1 Channels Alleviates Thalamic Hemorrhage-Induced Pain and Inflammatory Depolarization of Microglia in Mice.", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" }, { "database": "PubMed", "id": "37377340", "url": "https://glygen.org/publication/PubMed/37377340" } ] }, { "annotation": "Expression of pannexin1 in the hippocampus and inferior olive.", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" }, { "database": "PubMed", "id": "15661370", "url": "https://glygen.org/publication/PubMed/15661370" } ] }, { "annotation": "Pannexin 1 targets mitophagy to mediate renal ischemia/reperfusion injury. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" }, { "database": "PubMed", "id": "37644178", "url": "https://glygen.org/publication/PubMed/37644178" } ] }, { "annotation": "Pannexin-1 Modulates Inhibitory Transmission and Hippocampal Synaptic Plasticity. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" }, { "database": "PubMed", "id": "37371467", "url": "https://glygen.org/publication/PubMed/37371467" } ] }, { "annotation": "Structural component of the gap junctions and the hemichannels involved in the ATP release and nucleotide permeation. May play a role as a Ca(2+)-leak channel to regulate ER Ca(2+) homeostasis. Plays a critical role in oogenesis.", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4#function" }, { "database": "UniProtKB", "id": "Q96RD7", "url": "https://www.uniprot.org/uniprot/Q96RD7#function" } ] }, { "annotation": "Structural component of the gap junctions and the hemichannels. May play a role as a Ca(2+)-leak channel to regulate ER Ca(2+) homeostasis (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4#function" } ] }, { "annotation": "The Pannexin 1 Channel and the P2X7 Receptor Are in Complex Interplay to Regulate the Release of Soluble Ectonucleotidases in the Murine Bladder Lamina Propria. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" }, { "database": "PubMed", "id": "37373111", "url": "https://glygen.org/publication/PubMed/37373111" } ] }, { "annotation": "The Panx1 expresses in the brain, retina and other non-neuronal tissues. In the cortex, cerebellum and eye, Panx1 is expressed at early embryonic time points and peaks around embryonic day 18 followed by a decline towards adulthood.", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" }, { "database": "PubMed", "id": "16026466", "url": "https://glygen.org/publication/PubMed/16026466" } ] }, { "annotation": "The different expression patterns of Px1 and Px2 in the brain indicate that pannexins form cell type-specific gap junctions with distinct properties that may subserve different functions [pannexin 2]", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" }, { "database": "PubMed", "id": "14597722", "url": "https://glygen.org/publication/PubMed/14597722" } ] } ], "disease": [ { "disease_id": "DOID:0110861", "recommended_name": { "id": "DOID:0110861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110861", "name": "autosomal recessive polycystic kidney disease", "description": "A polycystic kidney disease characterized by the presence of multiple cysts located_in the kidney resulting from ciliopathy that disrupts the function of primary cilium, inherited in an autosomal recessive fashion." }, "synonyms": [ { "id": "DOID:0110861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110861", "name": "Arpkd", "description": "" }, { "id": "DOID:0110861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110861", "name": "Pkhd1", "description": "" }, { "id": "DOID:0110861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110861", "name": "Polycystic Kidney Disease, Infantile, Type I", "description": "" }, { "id": "DOID:0110861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110861", "name": "Polycystic Kidney and Hepatic Disease 1", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease 4", "description": "A autosomal dominant polycystic kidney disease that has material basis in mutation in the PKD4 gene." }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease 4", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease 4, with or without hepatic disease", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "PKD3", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "PKD3, formerly", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "PKD4", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "hepatic fibrosis, congenital", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney and hepatic disease 1", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease 4 with or without hepatic disease", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease 4 with or without polycystic liver disease", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease, autosomal recessive", "description": "" }, { "id": "MONDO:0033004", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0033004", "name": "polycystic kidney disease, infantile, type 1", "description": "" }, { "id": "MIM:263200", "resource": "MIM", "url": "https://www.omim.org/entry/263200", "name": "Polycystic kidney disease 4, with or without polycystic liver disease", "description": "Polycystic kidney disease 4, with or without polycystic liver disease" } ], "evidence": [ { "id": "0110861", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0110861" } ] } ], "snv": [ { "evidence": [ { "id": "rs249266579", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs249266579" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 424, "end_pos": 424, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NSS).", "chr_id": "9", "chr_pos": "14917445", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P424", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 254, "end_pos": 254, "sequence_org": "N", "sequence_mut": "Q", "comment": "Impairs glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" }, { "database": "PubMed", "id": "17925379", "url": "https://glygen.org/publication/PubMed/17925379" } ] }, { "start_pos": 346, "end_pos": 346, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes S-nitrosylation; when associated with Ala-40.", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" }, { "database": "PubMed", "id": "23033481", "url": "https://glygen.org/publication/PubMed/23033481" } ] }, { "start_pos": 40, "end_pos": 40, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes S-nitrosylation; when associated with Ala-346.", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" }, { "database": "PubMed", "id": "23033481", "url": "https://glygen.org/publication/PubMed/23033481" } ] }, { "start_pos": 426, "end_pos": 426, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on S-nitrosylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" }, { "database": "PubMed", "id": "23033481", "url": "https://glygen.org/publication/PubMed/23033481" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Panx1", "url": "https://www.uniprot.org/uniprot/Q9JIP4", "locus": { "chromosome": "9", "start_pos": 14913424, "end_pos": 14956774, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000031934", "url": "https://www.ensembl.org/id/ENSMUSG00000031934" } ] } } ], "crossref": [ { "id": "ENSMUSG00000031934", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000031934", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL4879520", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4879520", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "55991", "url": "https://www.ncbi.nlm.nih.gov/gene/55991", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9JIP4", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9JIP4*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000990", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000990", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039099", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039099", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:55991", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:55991", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1860055", "url": "http://www.informatics.jax.org/marker/MGI:1860055", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "IPDRFQC", "url": "https://omabrowser.org/oma/group/IPDRFQC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2996841at2759", "url": "http://www.orthodb.org/?query=2996841at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15759", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15759", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15759:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15759:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "8A3B", "url": "https://www.rcsb.org/structure/8A3B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00876", "url": "http://pfam.xfam.org/family/PF00876", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9JIP4", "url": "http://purl.obolibrary.org/obo/PR_Q9JIP4", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-112303", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-112303", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-844456", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-844456", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B1PL19", "url": "https://www.uniprot.org/uniprot/B1PL19", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B1PL19-1", "url": "https://www.uniprot.org/uniprot/B1PL19-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PY07", "url": "https://www.uniprot.org/uniprot/E9PY07", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PY07-1", "url": "https://www.uniprot.org/uniprot/E9PY07-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JIP4-1", "url": "https://www.uniprot.org/uniprot/Q9JIP4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAIAHLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPSSFSWRQAAFVDSYCWAAVQQKSSLQSESGNLPLWLHKFFPYILLLFAILLYLPALFWRFSAAPHLCSDLKFIMEELDKVYNRAIKAAKSARDLDLRDGPGPPGVTENVGQSLWEISESHFKYPIVEQYLKTKKNSSHLIMKYISCRLVTFVVILLACIYLSYYFSLSSLSDEFLCSIKSGVLKNDSTIPDRFQCKLIAVGIFQLLSLINLIVYALLIPVVVYTFFIPFRQKTDILKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISELKSYKCLKVLENIKSNGQGIDPMLLLTNLGMIKMDIIDGKIPTSLQTKGEDQGSQRVEFKDLDLSSEAAANNGEKNSRQRLLNPSC", "length": 426, "header": "sp|Q9JIP4-1|PANX1_MOUSE Isoform 1 of Pannexin-1 OS=Mus musculus OX=10090 GN=Panx1 PE=1 SV=3 CANONICAL=Q9JIP4-1" }, "isoforms": [ { "isoform_ac": "B1PL19-1", "url": "", "sequence": { "sequence": "MAIAHLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPSSFSWRQAAFVDSYCWAAVQQKSSLQSESGNLPLWLHKSVGDI", "length": 112, "header": "tr|B1PL19-1|PANX1_MOUSE Computationally mapped isoform of Pannexin-1 OS=Mus musculus OX=10090 GN=Panx1 PE=1 SV=1 CANONICAL=Q9JIP4-1" }, "locus": { "chromosome": "9", "start_pos": 14956333, "end_pos": 14919301, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000056755.8", "url": "https://www.ensembl.org/id/ENSMUST00000056755.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000053557.8", "url": "https://www.ensembl.org/id/ENSMUSP00000053557.8" } ] } }, { "isoform_ac": "E9PY07-1", "url": "", "sequence": { "sequence": "MEELDKVYNRAIKAAKSARDLD", "length": 22, "header": "tr|E9PY07-1|PANX1_MOUSE Computationally mapped isoform of Pannexin-1 OS=Mus musculus OX=10090 GN=Panx1 PE=1 SV=1 CANONICAL=Q9JIP4-1" }, "locus": { "chromosome": "9", "start_pos": 14921447, "end_pos": 14921382, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000169288.2", "url": "https://www.ensembl.org/id/ENSMUST00000169288.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000132764.2", "url": "https://www.ensembl.org/id/ENSMUSP00000132764.2" } ] } }, { "isoform_ac": "Q9JIP4-1", "url": "", "sequence": { "sequence": "MAIAHLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPSSFSWRQAAFVDSYCWAAVQQKSSLQSESGNLPLWLHKFFPYILLLFAILLYLPALFWRFSAAPHLCSDLKFIMEELDKVYNRAIKAAKSARDLDLRDGPGPPGVTENVGQSLWEISESHFKYPIVEQYLKTKKNSSHLIMKYISCRLVTFVVILLACIYLSYYFSLSSLSDEFLCSIKSGVLKNDSTIPDRFQCKLIAVGIFQLLSLINLIVYALLIPVVVYTFFIPFRQKTDILKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISELKSYKCLKVLENIKSNGQGIDPMLLLTNLGMIKMDIIDGKIPTSLQTKGEDQGSQRVEFKDLDLSSEAAANNGEKNSRQRLLNPSC", "length": 426, "header": "sp|Q9JIP4-1|PANX1_MOUSE Isoform 1 of Pannexin-1 OS=Mus musculus OX=10090 GN=Panx1 PE=1 SV=3 CANONICAL=Q9JIP4-1" }, "locus": { "chromosome": "9", "start_pos": 14956333, "end_pos": 14917437, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000164273", "url": "https://www.ensembl.org/id/ENSMUST00000164273" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000126405", "url": "https://www.ensembl.org/id/ENSMUSP00000126405" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 254, "start_aa": "Asn", "end_pos": 254, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn254", "evidence": [ { "id": "Q9JIP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIP4#ptm_processing" }, { "id": "17925379", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17925379" } ] } ], "phosphorylation": [ { "start_pos": 198, "end_pos": 198, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9JIP4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JIP4" }, { "database": "PubMed", "id": "26242575", "url": "https://glygen.org/publication/PubMed/26242575" } ], "site_lbl": "Tyr198" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported" ], "publication": [ { "title": "A ubiquitous family of putative gap junction molecules.", "journal": "Curr. Biol.", "date": "2000", "authors": "Panchin Y, Kelmanson I, Matz M, Lukyanov K, Usman N, Lukyanov S", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "reference": [ { "type": "PubMed", "id": "10898987", "url": "https://glygen.org/publication/PubMed/10898987" } ] }, { "title": "Pannexins, a family of gap junction proteins expressed in brain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Bruzzone R, Hormuzdi SG, Barbe MT, Herb A, Monyer H", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" } ], "reference": [ { "type": "PubMed", "id": "14597722", "url": "https://glygen.org/publication/PubMed/14597722" } ] }, { "title": "Expression of neural connexins and pannexin1 in the hippocampus and inferior olive: a quantitative approach.", "journal": "Brain research. Molecular brain research", "date": "2005", "authors": "Weickert S, Ray A, Zoidl G, Dermietzel R", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" } ], "reference": [ { "type": "PubMed", "id": "15661370", "url": "https://glygen.org/publication/PubMed/15661370" } ] }, { "title": "Site-specific and developmental expression of pannexin1 in the mouse nervous system.", "journal": "The European journal of neuroscience", "date": "2005", "authors": "Ray A, Zoidl G, Weickert S, Wahle P, Dermietzel R", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" } ], "reference": [ { "type": "PubMed", "id": "16026466", "url": "https://glygen.org/publication/PubMed/16026466" } ] }, { "title": "Pannexin 1 and pannexin 3 are glycoproteins that exhibit many distinct characteristics from the connexin family of gap junction proteins.", "journal": "Journal of cell science", "date": "2007", "authors": "Penuela S, Bhalla R, Gong XQ, Cowan KN, Celetti SJ, Cowan BJ, Bai D, Shao Q, Laird DW", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4#ptm_processing" }, { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "reference": [ { "type": "PubMed", "id": "17925379", "url": "https://glygen.org/publication/PubMed/17925379" } ] }, { "title": "S-nitrosylation inhibits pannexin 1 channel function.", "journal": "J. Biol. Chem.", "date": "2012", "authors": "Lohman AW, Weaver JL, Billaud M, Sandilos JK, Griffiths R, Straub AC, Penuela S, Leitinger N, Laird DW, Bayliss DA, Isakson BE", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "reference": [ { "type": "PubMed", "id": "23033481", "url": "https://glygen.org/publication/PubMed/23033481" } ] }, { "title": "Pannexin 1 channels regulate leukocyte emigration through the venous endothelium during acute inflammation.", "journal": "Nature communications", "date": "2015", "authors": "Lohman AW, Leskov IL, Butcher JT, Johnstone SR, Stokes TA, Begandt D, DeLalio LJ, Best AK, Penuela S, Leitinger N, Ravichandran KS, Stokes KY, Isakson BE", "evidence": [ { "database": "iPTMnet", "id": "Q9JIP4", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JIP4" } ], "reference": [ { "type": "PubMed", "id": "26242575", "url": "https://glygen.org/publication/PubMed/26242575" } ] }, { "title": "Astrocyte and Neuronal Panx1 Support Long-Term Reference Memory in Mice.", "journal": "ASN neuro", "date": "2023", "authors": "Obot Price, Subah Galadu, Schonwald Antonia, Pan Jian, Vel\u00ed\u0161ek Libor, Vel\u00ed\u0161kov\u00e1 Jana, Stanton Patric K, Scemes Eliana", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" } ], "reference": [ { "type": "PubMed", "id": "37365910", "url": "https://glygen.org/publication/PubMed/37365910" } ] }, { "title": "Pannexin-1 Modulates Inhibitory Transmission and Hippocampal Synaptic Plasticity.", "journal": "Biomolecules", "date": "2023-05-25", "authors": "Garc\u00eda-Rojas Francisca, Flores-Mu\u00f1oz Carolina, Santander Odra, Solis Pamela, Mart\u00ednez Agust\u00edn D, Ardiles \u00c1lvaro O, Fuenzalida Marco", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" } ], "reference": [ { "type": "PubMed", "id": "37371467", "url": "https://glygen.org/publication/PubMed/37371467" } ] }, { "title": "The Pannexin 1 Channel and the P2X7 Receptor Are in Complex Interplay to Regulate the Release of Soluble Ectonucleotidases in the Murine Bladder Lamina Propria.", "journal": "International journal of molecular sciences", "date": "2023-06-09", "authors": "Aresta Branco Mafalda S L, Gutierrez Cruz Alejandro, Peri Lauren E, Mutafova-Yambolieva Violeta N", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" } ], "reference": [ { "type": "PubMed", "id": "37373111", "url": "https://glygen.org/publication/PubMed/37373111" } ] }, { "title": "Blocking Pannexin-1 Channels Alleviates Thalamic Hemorrhage-Induced Pain and Inflammatory Depolarization of Microglia in Mice.", "journal": "ACS chemical neuroscience", "date": "2023-07-19", "authors": "Bu Fan, Li Yuerong, Lan Shiming, Yang Taiqin, He Baokun, Dong Peng, Shen Fengyan, Cai Haobin, Lu Yunwei, Fei Yong, Xu Longsheng, Qin Xiude", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" } ], "reference": [ { "type": "PubMed", "id": "37377340", "url": "https://glygen.org/publication/PubMed/37377340" } ] }, { "title": "Pannexin 1 targets mitophagy to mediate renal ischemia/reperfusion injury.", "journal": "Communications biology", "date": "2023-08-29", "authors": "Su Lianjiu, Zhang Jiahao, Wang Jing, Wang Xiaozhan, Cao Edward, Yang Chen, Sun Qihao, Sivakumar Ramadoss, Peng Zhiyong", "evidence": [ { "database": "RefSeq", "id": "NP_062355", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_062355" } ], "reference": [ { "type": "PubMed", "id": "37644178", "url": "https://glygen.org/publication/PubMed/37644178" } ] } ], "pathway": [ { "id": "mmu:55991", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:55991", "resource": "KEGG Pathway" }, { "id": "R-MMU-112303", "name": "Electric Transmission Across Gap Junctions", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-112303", "resource": "Reactome", "description": "Electric Transmission Across Gap Junctions" }, { "id": "R-MMU-844456", "name": "The NLRP3 inflammasome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-844456", "resource": "Reactome", "description": "The NLRP3 inflammasome" } ], "orthologs": [ { "uniprot_canonical_ac": "P60570-1", "protein_name": "Pannexin-1", "gene_name": "Panx1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAIAHLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPALFWRFAAAPHLCSDLKFIMEELDKVYNRAIKAAKSARDLDLRDGPGPPGVTENVGQSLWEISESHFKYPIVEQYLKTKKNSSHLIMKYISCRLVTFAVVLLACIYLSYYFSLSSLSDEFLCSIKSGVLRNDSTIPDSFQCKLIAVGIFQLLSLINLLVYALLVPVVIYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISELKSYKCLKVLENIKSNGQGIDPMLLLTNLGMIKMDVIDGKVPMSLQTKGEDQGSQRMDFKDLDLSSETAANNGEKNSRQRLLNSSC", "length": 426 }, "evidence": [ { "id": "45229795", "url": "http://www.informatics.jax.org/homology/45229795", "database": "MGI" }, { "id": "Q9JIP4", "url": "https://omabrowser.org/oma/group/Q9JIP4/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q96RD7-1", "protein_name": "Pannexin-1", "gene_name": "PANX1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAIAQLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC", "length": 426 }, "evidence": [ { "id": "45229795", "url": "http://www.informatics.jax.org/homology/45229795", "database": "MGI" }, { "id": "Q9JIP4", "url": "https://omabrowser.org/oma/group/Q9JIP4/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 14, "go_terms": [ { "name": "channel activity", "id": "GO:0015267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015267", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "actin binding", "id": "GO:0003779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003779", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "calcium channel activity", "id": "GO:0005262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005262", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "actin filament binding", "id": "GO:0051015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051015", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "transmembrane transporter binding", "id": "GO:0044325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044325", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "structural molecule activity", "id": "GO:0005198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005198", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "scaffold protein binding", "id": "GO:0097110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097110", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "wide pore channel activity", "id": "GO:0022829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022829", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "gap junction channel activity", "id": "GO:0005243", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005243", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "leak channel activity", "id": "GO:0022840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022840", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "monoatomic cation transport", "id": "GO:0006812", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006812", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 production", "id": "GO:0032732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032732", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 alpha production", "id": "GO:0032730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032730", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "response to ischemia", "id": "GO:0002931", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002931", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "cell-cell signaling", "id": "GO:0007267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007267", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "calcium ion transport", "id": "GO:0006816", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006816", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "positive regulation of interleukin-1 beta production", "id": "GO:0032731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032731", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "response to ATP", "id": "GO:0033198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033198", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "positive regulation of macrophage cytokine production", "id": "GO:0060907", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060907", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "bleb", "id": "GO:0032059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032059", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "gap junction", "id": "GO:0005921", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005921", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 254, "end_pos": 256, "annotation": "n_glycosylation_sequon" }, { "start_pos": 337, "end_pos": 339, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylation may play a role in cell surface targeting (PubMed:17925379). Exists in three glycosylation states: non-glycosylated (GLY0), high-mannose glycosylated (GLY1), and fully mature glycosylated (GLY2) (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" }, { "database": "PubMed", "id": "17925379", "url": "https://glygen.org/publication/PubMed/17925379" }, { "database": "PubMed", "id": "Q96RD7", "url": "https://glygen.org/publication/PubMed/Q96RD7" } ] }, { "annotation": "S-nitrosylation inhibits channel currents and ATP release.", "evidence": [ { "database": "UniProtKB", "id": "Q9JIP4", "url": "https://www.uniprot.org/uniprot/Q9JIP4" }, { "database": "PubMed", "id": "23033481", "url": "https://glygen.org/publication/PubMed/23033481" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }