{ "uniprot_canonical_ac": "Q9JII2-1", "uniprot_ac": "Q9JII2", "uniprot_id": "PR5A1_MOUSE", "mass": { "chemical_mass": 26556.0, "monoisotopic_mass": 26556.0 }, "refseq": { "ac": "NP_076235", "name": "prolactin-5A1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076235" }, "gene_names": [ { "name": "Prl5a1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9JII2", "id": "Q9JII2" }, { "name": "1600013P04Rik; D13Wsu14e; Ghd24; PLP-L; Prlpl", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076235", "id": "NP_076235" }, { "name": "D13Wsu14e", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9JII2", "id": "Q9JII2" }, { "name": "Prl5a1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076235", "id": "NP_076235" }, { "name": "Prlpl", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9JII2", "id": "Q9JII2" } ], "protein_names": [ { "name": "Prolactin-5A1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9JII2" }, { "name": "PLP-L", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JII2" }, { "name": "PRL-like protein L", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JII2" }, { "name": "Placental prolactin-like protein L", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JII2" }, { "name": "prolactin-5A1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076235", "id": "NP_076235" }, { "name": "prolactin-5A1; PRL-like protein L; placental prolactin-like protein L; growth hormone d24", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076235", "id": "NP_076235" } ], "function": [ { "annotation": "Both interstitial and endovascular rat trophoblast cells synthesize PLP-L.", "evidence": [ { "database": "RefSeq", "id": "NP_076235", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076235" }, { "database": "PubMed", "id": "12885563", "url": "https://glygen.org/publication/PubMed/12885563" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3389277890", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389277890" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 133, "end_pos": 133, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NMA->NMT).", "chr_id": "13", "chr_pos": "28333895", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A133", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Prl5a1", "url": "https://www.uniprot.org/uniprot/Q9JII2", "locus": { "chromosome": "13", "start_pos": 28335594, "end_pos": 28326467, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000017064", "url": "https://www.ensembl.org/id/ENSMUSG00000017064" } ] } } ], "crossref": [ { "id": "ENSMUSG00000017064", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000017064", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "28078", "url": "https://www.ncbi.nlm.nih.gov/gene/28078", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001400", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001400", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:28078", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:28078", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "106332", "url": "http://www.informatics.jax.org/marker/MGI:106332", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "AWSGEPY", "url": "https://omabrowser.org/oma/group/AWSGEPY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4823151at2759", "url": "http://www.orthodb.org/?query=4823151at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11417", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11417", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11417:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11417:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00103", "url": "http://pfam.xfam.org/family/PF00103", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9JII2", "url": "http://purl.obolibrary.org/obo/PR_Q9JII2", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_076235", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076235", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JII2-1", "url": "https://www.uniprot.org/uniprot/Q9JII2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRLSKIQPHQSGTLLLLLLSNLLMWENVASVPRCIMEDGGCQKVLNYIFNMTSTISENFNNLSSETLNDFDTEYDPHQKFQNRPTMTCHTSSRSVPNNKRKAERMRPVVLLNVTIRMLAAWKNLLHHVENNMADLDGTPYVIISKVKLIDRQIKKLTKNLQNIKTILSQVNPDLKKNEDYPAWSGEPYVQQSKRRVQLFGLHSLFFCLNNDAQKVSDFISILRDQIVPNQ", "length": 230, "header": "sp|Q9JII2-1|PR5A1_MOUSE Isoform 1 of Prolactin-5A1 OS=Mus musculus OX=10090 GN=Prl5a1 PE=2 SV=1 CANONICAL=Q9JII2-1" }, "isoforms": [ { "isoform_ac": "Q9JII2-1", "url": "", "sequence": { "sequence": "MRLSKIQPHQSGTLLLLLLSNLLMWENVASVPRCIMEDGGCQKVLNYIFNMTSTISENFNNLSSETLNDFDTEYDPHQKFQNRPTMTCHTSSRSVPNNKRKAERMRPVVLLNVTIRMLAAWKNLLHHVENNMADLDGTPYVIISKVKLIDRQIKKLTKNLQNIKTILSQVNPDLKKNEDYPAWSGEPYVQQSKRRVQLFGLHSLFFCLNNDAQKVSDFISILRDQIVPNQ", "length": 230, "header": "sp|Q9JII2-1|PR5A1_MOUSE Isoform 1 of Prolactin-5A1 OS=Mus musculus OX=10090 GN=Prl5a1 PE=2 SV=1 CANONICAL=Q9JII2-1" }, "locus": { "chromosome": "13", "start_pos": 28335282, "end_pos": 28326526, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000017208", "url": "https://www.ensembl.org/id/ENSMUST00000017208" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000017208", "url": "https://www.ensembl.org/id/ENSMUSP00000017208" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 112, "start_aa": "Asn", "end_pos": 112, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn112", "evidence": [ { "id": "Q9JII2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII2#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 50, "start_aa": "Asn", "end_pos": 50, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn50", "evidence": [ { "id": "Q9JII2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII2#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 61, "start_aa": "Asn", "end_pos": 61, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn61", "evidence": [ { "id": "Q9JII2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII2#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Identification of three prolactin-related hormones as markers of invasive trophoblasts in the rat.", "journal": "Biol. Reprod.", "date": "2000", "authors": "Toft DJ, Linzer DI", "evidence": [ { "database": "UniProtKB", "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2" } ], "reference": [ { "type": "PubMed", "id": "10906059", "url": "https://glygen.org/publication/PubMed/10906059" } ] }, { "title": "Gestation stage-dependent intrauterine trophoblast cell invasion in the rat and mouse: novel endocrine phenotype and regulation.", "journal": "Developmental biology", "date": "2003", "authors": "Ain R, Canham LN, Soares MJ", "evidence": [ { "database": "RefSeq", "id": "NP_076235", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_076235" } ], "reference": [ { "type": "PubMed", "id": "12885563", "url": "https://glygen.org/publication/PubMed/12885563" } ] } ], "pathway": [ { "id": "mmu:28078", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:28078", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9JII4-1", "protein_name": "Prolactin-5A1", "gene_name": "Prl5a1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MQIQPHPSGALLLLLLSNLLMWENVASVPRCIMENGGCQKVLNYLFNMTSTISESFNTLSSETLNDFYTEFDPHQTFQNRPAMTCHTSSRSIPNNKRKAERMEPAALLNVIIRMLASWKNLLYHVENNMANLDGTPYAIISKVKLIDRQIKKLTKNLQDIKTILSQVHPELKEKENYPVWSGEPYVQKSKRRTQLFGLHSLFFCLYSDAEKVSDYVNILRNKIVPNE", "length": 227 }, "evidence": [ { "id": "45245543", "url": "http://www.informatics.jax.org/homology/45245543", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "prolactin receptor binding", "id": "GO:0005148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005148", "evidence": [ { "database": "UniProtKB", "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2" } ], "pmid": "" }, { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2" } ], "pmid": "" }, { "name": "response to nutrient levels", "id": "GO:0031667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031667", "evidence": [ { "database": "UniProtKB", "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2" } ], "pmid": "" }, { "name": "female pregnancy", "id": "GO:0007565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007565", "evidence": [ { "database": "UniProtKB", "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2" } ], "pmid": "" }, { "name": "positive regulation of receptor signaling pathway via JAK-STAT", "id": "GO:0046427", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046427", "evidence": [ { "database": "UniProtKB", "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2" } ], "pmid": "" }, { "name": "mammary gland development", "id": "GO:0030879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030879", "evidence": [ { "database": "UniProtKB", "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2" } ], "pmid": "" }, { "name": "positive regulation of lactation", "id": "GO:1903489", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903489", "evidence": [ { "database": "UniProtKB", "id": "Q9JII2", "url": "https://www.uniprot.org/uniprot/Q9JII2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 112, "end_pos": 114, "annotation": "n_glycosylation_sequon" }, { "start_pos": 50, "end_pos": 52, "annotation": "n_glycosylation_sequon" }, { "start_pos": 61, "end_pos": 63, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }