{ "uniprot_canonical_ac": "Q9JID9-1", "uniprot_ac": "Q9JID9", "uniprot_id": "SH2B2_MOUSE", "mass": { "chemical_mass": 66557.0, "monoisotopic_mass": 66557.0 }, "refseq": { "ac": "NP_001289868", "name": "SH2B adapter protein 2 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868" }, "gene_names": [ { "name": "Sh2b2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9JID9", "id": "Q9JID9" }, { "name": "Aps", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868", "id": "NP_001289868" }, { "name": "Aps", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9JID9", "id": "Q9JID9" }, { "name": "Sh2b2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868", "id": "NP_001289868" } ], "protein_names": [ { "name": "SH2B adapter protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9JID9" }, { "name": "Adapter protein with pleckstrin homology and Src homology 2 domains", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JID9" }, { "name": "SH2 and PH domain-containing adapter protein APS", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9JID9" }, { "name": "SH2B adapter protein 2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867", "id": "NP_001289867" }, { "name": "SH2B adapter protein 2 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868", "id": "NP_001289868" }, { "name": "insulin receptor substrate 5; SH2B adapter protein 2; SH2 and PH domain-containing adapter protein APS; adapter protein with pleckstrin homology and Src homology 2 domains; adaptor protein with pleckstrin homology and src homology 2 domains", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867", "id": "NP_001289867" } ], "function": [ { "annotation": "APS enhanced ligand-dependent multi-ubiquitination of the insulin receptor (IR) in CHO cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001289868", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868" }, { "database": "PubMed", "id": "17102568", "url": "https://glygen.org/publication/PubMed/17102568" }, { "database": "RefSeq", "id": "NP_001289867", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867" } ] }, { "annotation": "APS facilitates c-Cbl tyrosine phosphorylation and GLUT4 translocation in response to insulin in 3T3-L1 adipocytes", "evidence": [ { "database": "RefSeq", "id": "NP_001289868", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868" }, { "database": "PubMed", "id": "11997497", "url": "https://glygen.org/publication/PubMed/11997497" }, { "database": "RefSeq", "id": "NP_001289867", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867" } ] }, { "annotation": "Adapter protein for several members of the tyrosine kinase receptor family. Involved in multiple signaling pathways. May be involved in coupling from immunoreceptor to Ras signaling. Acts as a negative regulator of cytokine signaling in collaboration with CBL. Binds to EPOR and suppresses EPO-induced STAT5 activation, possibly through a masking effect on STAT5 docking sites in EPOR. Suppresses PDGF-induced mitogenesis. May induce cytoskeletal reorganization via interaction with VAV3 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9#function" } ] }, { "annotation": "Deletion of liver SH2B1 in SH2B2 null mice attenuated very low-density lipoprotein (VLDL) secretion. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001289868", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868" }, { "database": "PubMed", "id": "24358267", "url": "https://glygen.org/publication/PubMed/24358267" }, { "database": "RefSeq", "id": "NP_001289867", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867" } ] }, { "annotation": "SH2B2beta is an endogenous inhibitor of SH2B1 and/or SH2B2alpha, negatively regulating insulin signaling and/or JAK2-mediated cellular responses.", "evidence": [ { "database": "RefSeq", "id": "NP_001289868", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868" }, { "database": "PubMed", "id": "17204555", "url": "https://glygen.org/publication/PubMed/17204555" }, { "database": "RefSeq", "id": "NP_001289867", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867" } ] }, { "annotation": "The association between SHIP2 and the adaptor protein Aps has an impact on biochemical properties of both partners.", "evidence": [ { "database": "RefSeq", "id": "NP_001289868", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868" }, { "database": "PubMed", "id": "17620296", "url": "https://glygen.org/publication/PubMed/17620296" }, { "database": "RefSeq", "id": "NP_001289867", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Sh2b2", "url": "https://www.uniprot.org/uniprot/Q9JID9", "locus": { "chromosome": "5", "start_pos": 136247001, "end_pos": 136275410, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000005057", "url": "https://www.ensembl.org/id/ENSMUSG00000005057" } ] } } ], "crossref": [ { "id": "ENSMUSG00000005057", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000005057", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01231", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01231", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd10411", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10411", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "23921", "url": "https://www.ncbi.nlm.nih.gov/gene/23921", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9JID9", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9JID9*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000980", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000980", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001849", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001849", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011993", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011993", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015012", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015012", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030523", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030523", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035058", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035058", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036290", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036290", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036860", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036860", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:23921", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:23921", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1345171", "url": "http://www.informatics.jax.org/marker/MGI:1345171", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "YHRMEGT", "url": "https://omabrowser.org/oma/group/YHRMEGT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2995825at2759", "url": "http://www.orthodb.org/?query=2995825at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10872", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10872", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10872:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10872:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1V5M", "url": "https://www.rcsb.org/structure/1V5M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00017", "url": "http://pfam.xfam.org/family/PF00017", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00169", "url": "http://pfam.xfam.org/family/PF00169", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08916", "url": "http://pfam.xfam.org/family/PF08916", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9JID9", "url": "http://purl.obolibrary.org/obo/PR_Q9JID9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1433559", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1433559", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-983231", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983231", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001289867", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0G2JDV1", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JDV1-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JDV1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JED4", "url": "https://www.uniprot.org/uniprot/A0A0G2JED4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JED4-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JED4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9JID9-1", "url": "https://www.uniprot.org/uniprot/Q9JID9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNGATPSSAAAPAPVPDWRQFCELHAQVAAVDFAHKFCRFLRDNPTYDTPDAGTSFSRHFAANFLAVFSEEVRRVLGSAADTMEPEPAVTSVTSALKTATYGHSRSSEDVSAHAATKARVRKGFSLRNMSLCVVDGVRDLWHRRSSPEPDGGATPKAAEPASEPRDKWTRRLRLARTLAAKVELVDIQREGALRFMVADDAASGPGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDPGDSEEDTGLSCARGGCLASRVASCSCELLTDADMPRPPETTTAVGAVVTAPHGRARDTVGESLAHVPLETFLQTLESSGGVSENNNPGDEGAELDTDAEAELELSDYPWFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVFDMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPDPGPAPNTAAPVPACWTEPAGQHYFSSLATATCPPASPSNGAGASSSSGSSSSATSLPPRPAEGPLSAHSRSNSTEHLLDAASGATEEPTEATLGRARAVENQYSFY", "length": 621, "header": "sp|Q9JID9-1|SH2B2_MOUSE Isoform 1 of SH2B adapter protein 2 OS=Mus musculus OX=10090 GN=Sh2b2 PE=1 SV=2 CANONICAL=Q9JID9-1" }, "isoforms": [ { "isoform_ac": "A0A0G2JDV1-1", "url": "", "sequence": { "sequence": "MNGATPSSAAAPAPVPDWRQFCELHAQVAAVDFAHKFCRFLRDN", "length": 44, "header": "tr|A0A0G2JDV1-1|SH2B2_MOUSE Computationally mapped isoform of SH2B adapter protein 2 OS=Mus musculus OX=10090 GN=Sh2b2 PE=1 SV=1 CANONICAL=Q9JID9-1" }, "locus": { "chromosome": "5", "start_pos": 136261214, "end_pos": 136261083, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000196245.2", "url": "https://www.ensembl.org/id/ENSMUST00000196245.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142515.2", "url": "https://www.ensembl.org/id/ENSMUSP00000142515.2" } ] } }, { "isoform_ac": "A0A0G2JED4-1", "url": "", "sequence": { "sequence": "MNGATPSSAAAPAPVPDWRQFCELHAQVAAVDFAHKFCRFLRDNPTYDTPDAGTSFSRHFAANFLAVFSEEVRRVLGSAADTMEPEPAVTSVTSALKTATYGHSRSSEDVSAHAATKARVRKGFSLRNMSLCVVDGVRDLWHRRSSPEPDGGATPKAAEPASEPRDKWTRRLRLARTLAAKVELVDIQREGALRFMVADDAASGPGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDPGDSEEDTGLSCARGGCLASRVASCSCELLTDADMPRPPETTTAVGAVVTAPHGRARDTVGESLAHVPLETFLQTLESSGGVSENNNPGTTGVPTPFYRDPCGASEVVTFQPVVSTVVLAF", "length": 420, "header": "tr|A0A0G2JED4-1|SH2B2_MOUSE Computationally mapped isoform of SH2B adapter protein 2 OS=Mus musculus OX=10090 GN=Sh2b2 PE=1 SV=1 CANONICAL=Q9JID9-1" }, "locus": { "chromosome": "5", "start_pos": 136261214, "end_pos": 136252911, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000196447.2", "url": "https://www.ensembl.org/id/ENSMUST00000196447.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142728.2", "url": "https://www.ensembl.org/id/ENSMUSP00000142728.2" } ] } }, { "isoform_ac": "Q9JID9-1", "url": "", "sequence": { "sequence": "MNGATPSSAAAPAPVPDWRQFCELHAQVAAVDFAHKFCRFLRDNPTYDTPDAGTSFSRHFAANFLAVFSEEVRRVLGSAADTMEPEPAVTSVTSALKTATYGHSRSSEDVSAHAATKARVRKGFSLRNMSLCVVDGVRDLWHRRSSPEPDGGATPKAAEPASEPRDKWTRRLRLARTLAAKVELVDIQREGALRFMVADDAASGPGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDPGDSEEDTGLSCARGGCLASRVASCSCELLTDADMPRPPETTTAVGAVVTAPHGRARDTVGESLAHVPLETFLQTLESSGGVSENNNPGDEGAELDTDAEAELELSDYPWFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVFDMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPDPGPAPNTAAPVPACWTEPAGQHYFSSLATATCPPASPSNGAGASSSSGSSSSATSLPPRPAEGPLSAHSRSNSTEHLLDAASGATEEPTEATLGRARAVENQYSFY", "length": 621, "header": "sp|Q9JID9-1|SH2B2_MOUSE Isoform 1 of SH2B adapter protein 2 OS=Mus musculus OX=10090 GN=Sh2b2 PE=1 SV=2 CANONICAL=Q9JID9-1" }, "locus": { "chromosome": "5", "start_pos": 136261214, "end_pos": 136247687, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000196397", "url": "https://www.ensembl.org/id/ENSMUST00000196397" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000142398", "url": "https://www.ensembl.org/id/ENSMUSP00000142398" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 130, "end_pos": 130, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" } ], "site_lbl": "Ser130" }, { "start_pos": 146, "end_pos": 146, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q9JID9", "url": "http://phospho.elm.eu.org/byAccession/Q9JID9.html" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ], "site_lbl": "Ser146" }, { "start_pos": 303, "end_pos": 303, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" } ], "site_lbl": "Ser303" }, { "start_pos": 47, "end_pos": 47, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" }, { "database": "PubMed", "id": "10872802", "url": "https://glygen.org/publication/PubMed/10872802" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" } ], "site_lbl": "Tyr47" }, { "start_pos": 588, "end_pos": 588, "kinase_uniprot_canonical_ac": "P31750-1", "kinase_gene_name": "Akt1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" }, { "database": "PubMed", "id": "16141217", "url": "https://glygen.org/publication/PubMed/16141217" } ], "site_lbl": "Ser588" }, { "start_pos": 588, "end_pos": 588, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" }, { "database": "PubMed", "id": "16141217", "url": "https://glygen.org/publication/PubMed/16141217" } ], "site_lbl": "Ser588" }, { "start_pos": 589, "end_pos": 589, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q9JID9", "url": "http://phospho.elm.eu.org/byAccession/Q9JID9.html" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ], "site_lbl": "Thr589" }, { "start_pos": 597, "end_pos": 597, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "Q9JID9", "url": "http://phospho.elm.eu.org/byAccession/Q9JID9.html" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" } ], "site_lbl": "Ser597" }, { "start_pos": 618, "end_pos": 618, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" }, { "database": "PubMed", "id": "10872802", "url": "https://glygen.org/publication/PubMed/10872802" }, { "database": "phospho.ELM", "id": "Q9JID9", "url": "http://phospho.elm.eu.org/byAccession/Q9JID9.html" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" }, { "database": "PubMed", "id": "10196204", "url": "https://glygen.org/publication/PubMed/10196204" }, { "database": "PubMed", "id": "11997497", "url": "https://glygen.org/publication/PubMed/11997497" } ], "site_lbl": "Tyr618" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Identification of the APS protein as a novel insulin receptor substrate.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Moodie SA, Alleman-Sposeto J, Gustafson TA", "evidence": [ { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" } ], "reference": [ { "type": "PubMed", "id": "10196204", "url": "https://glygen.org/publication/PubMed/10196204" } ] }, { "title": "Molecular cloning of the mouse APS as a member of the Lnk family adaptor proteins.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Iseki M, Takaki S, Takatsu K", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" } ], "reference": [ { "type": "PubMed", "id": "10872802", "url": "https://glygen.org/publication/PubMed/10872802" } ] }, { "title": "APS facilitates c-Cbl tyrosine phosphorylation and GLUT4 translocation in response to insulin in 3T3-L1 adipocytes.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Liu J, Kimura A, Baumann CA, Saltiel AR", "evidence": [ { "database": "RefSeq", "id": "NP_001289867", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867" }, { "database": "RefSeq", "id": "NP_001289868", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" } ], "reference": [ { "type": "PubMed", "id": "11997497", "url": "https://glygen.org/publication/PubMed/11997497" } ] }, { "title": "The adapter protein APS associates with the multifunctional docking sites Tyr-568 and Tyr-936 in c-Kit.", "journal": "Biochem. J.", "date": "2003", "authors": "Wollberg P, Lennartsson J, Gottfridsson E, Yoshimura A, Ronnstrand L", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "reference": [ { "type": "PubMed", "id": "12444928", "url": "https://glygen.org/publication/PubMed/12444928" } ] }, { "title": "Cross-talk between the two divergent insulin signaling pathways is revealed by the protein kinase B (Akt)-mediated phosphorylation of adapter protein APS on serine 588.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Katsanakis KD, Pillay TS", "evidence": [ { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" } ], "reference": [ { "type": "PubMed", "id": "16141217", "url": "https://glygen.org/publication/PubMed/16141217" } ] }, { "title": "APS-mediated ubiquitination of the insulin receptor enhances its internalization, but does not induce its degradation.", "journal": "Endocrine journal", "date": "2007", "authors": "Kishi K, Mawatari K, Sakai-Wakamatsu K, Yuasa T, Wang M, Ogura-Sawa M, Nakaya Y, Hatakeyama S, Ebina Y", "evidence": [ { "database": "RefSeq", "id": "NP_001289867", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867" }, { "database": "RefSeq", "id": "NP_001289868", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868" } ], "reference": [ { "type": "PubMed", "id": "17102568", "url": "https://glygen.org/publication/PubMed/17102568" } ] }, { "title": "Identification of SH2B2beta as an inhibitor for SH2B1- and SH2B2alpha-promoted Janus kinase-2 activation and insulin signaling.", "journal": "Endocrinology", "date": "2007", "authors": "Li M, Li Z, Morris DL, Rui L", "evidence": [ { "database": "RefSeq", "id": "NP_001289867", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867" }, { "database": "RefSeq", "id": "NP_001289868", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868" } ], "reference": [ { "type": "PubMed", "id": "17204555", "url": "https://glygen.org/publication/PubMed/17204555" } ] }, { "title": "Large-scale phosphorylation analysis of mouse liver.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2007", "authors": "Villen J, Beausoleil SA, Gerber SA, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" } ], "reference": [ { "type": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ] }, { "title": "The association between the SH2-containing inositol polyphosphate 5-Phosphatase 2 (SHIP2) and the adaptor protein APS has an impact on biochemical properties of both partners.", "journal": "Journal of cellular physiology", "date": "2008", "authors": "Onnockx S, De Schutter J, Blockmans M, Xie J, Jacobs C, Vanderwinden JM, Erneux C, Pirson I", "evidence": [ { "database": "RefSeq", "id": "NP_001289867", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867" }, { "database": "RefSeq", "id": "NP_001289868", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868" } ], "reference": [ { "type": "PubMed", "id": "17620296", "url": "https://glygen.org/publication/PubMed/17620296" } ] }, { "title": "The phagosomal proteome in interferon-gamma-activated macrophages.", "journal": "Immunity", "date": "2009", "authors": "Trost M, English L, Lemieux S, Courcelles M, Desjardins M, Thibault P", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" } ], "reference": [ { "type": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" }, { "database": "iPTMnet", "id": "Q9JID9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9JID9" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Hepatic SH2B1 and SH2B2 regulate liver lipid metabolism and VLDL secretion in mice.", "journal": "PloS one", "date": "2013", "authors": "Sheng L, Liu Y, Jiang L, Chen Z, Zhou Y, Cho KW, Rui L", "evidence": [ { "database": "RefSeq", "id": "NP_001289867", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289867" }, { "database": "RefSeq", "id": "NP_001289868", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289868" } ], "reference": [ { "type": "PubMed", "id": "24358267", "url": "https://glygen.org/publication/PubMed/24358267" } ] } ], "pathway": [ { "id": "mmu:23921", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:23921", "resource": "KEGG Pathway" }, { "id": "R-MMU-1433559", "name": "Regulation of KIT signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1433559", "resource": "Reactome", "description": "Regulation of KIT signaling" }, { "id": "R-MMU-983231", "name": "Factors involved in megakaryocyte development and platelet production", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-983231", "resource": "Reactome", "description": "Factors involved in megakaryocyte development and platelet production" } ], "orthologs": [ { "uniprot_canonical_ac": "O14492-1", "protein_name": "SH2B adapter protein 2", "gene_name": "SH2B2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNGAGPGPAAAAPVPVPVPVPDWRQFCELHAQAAAVDFAHKFCRFLRDNPAYDTPDAGASFSRHFAANFLDVFGEEVRRVLVAGPTTRGAAVSAEAMEPELADTSALKAAPYGHSRSSEDVSTHAATKARVRKGFSLRNMSLCVVDGVRDMWHRRASPEPDAAAAPRTAEPRDKWTRRLRLSRTLAAKVELVDIQREGALRFMVADDAAAGSGGSAQWQKCRLLLRRAVAEERFRLEFFVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDPGDSEEDTELSCTRGGCLASRVASCSCELLTDAVDLPRPPETTAVGAVVTAPHSRGRDAVRESLIHVPLETFLQTLESPGGSGSDSNNTGEQGAETDPEAEPELELSDYPWFHGTLSRVKAAQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVLDMLRHFHTHPIPLESGGSADITLRSYVRAQDPPPEPGPTPPAAPASPACWSDSPGQHYFSSLAAAACPPASPSDAAGASSSSASSSSAASGPAPPRPVEGQLSARSRSNSAERLLEAVAATAAEEPPEAAPGRARAVENQYSFY", "length": 632 }, "evidence": [ { "id": "45243635", "url": "http://www.informatics.jax.org/homology/45243635", "database": "MGI" }, { "id": "Q9JID9", "url": "https://omabrowser.org/oma/group/Q9JID9/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9Z200-1", "protein_name": "SH2B adapter protein 2", "gene_name": "Sh2b2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MNGATPGSAAAPAPVPDWRQFCELHAQVAAVDFAHKFCRFLRDNPTYDTPDAGTSFSRHFAANFLAVFSEEVRRVLGTAADTMEPEPAVTSVTSALKTATYGHSRSSEDVSAHVATKARVRKGFSLRNMSLCVVDGVRDLWHRRASPEPEGGATPKTTEPVSEPRDKWTRRLRLARTLAAKVELVDIQREGALRFMVADDAASGPGGTAQWQKCRLLLRRAVAGERFRLEFFVPPKASRPKVSIPLSAIIEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVADIQGCVDPGDSEEDTGLSCARGGCLASRVTSCSCELLTEADMPRPPETMTAVGAVVTAPHGRARDTVGESLAHVPLETFLQTLESSGGVSESNNTGDEGAELDPDAEAELELSDYPWFHGTLSRVKAAQLVLAGGPRSHGLFVIRQSETRPGECVLTFNFQGKAKHLRLSLNGHGQCHVQHLWFQSVFDMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPDPGPAPNTAAPVPACWTEPAGQHYFSSLATATCPPTSPSNGAGASSSSGSSSSATSVPPRPAEGPLSARSRSNSTEHLLEAASGATEEPADATLGRARAVENQYSFY", "length": 621 }, "evidence": [ { "id": "45243635", "url": "http://www.informatics.jax.org/homology/45243635", "database": "MGI" }, { "id": "Q9JID9", "url": "https://omabrowser.org/oma/group/Q9JID9/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 17, "go_terms": [ { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "glucose import", "id": "GO:0046323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046323", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "regulation of metabolic process", "id": "GO:0019222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019222", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "nervous system development", "id": "GO:0007399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "intracellular signal transduction", "id": "GO:0035556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "brown fat cell differentiation", "id": "GO:0050873", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050873", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "actin cytoskeleton organization", "id": "GO:0030036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030036", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "regulation of immune response", "id": "GO:0050776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050776", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "glucose homeostasis", "id": "GO:0042593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042593", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "B-1 B cell homeostasis", "id": "GO:0001922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001922", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "B cell receptor signaling pathway", "id": "GO:0050853", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050853", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "insulin receptor signaling pathway", "id": "GO:0008286", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008286", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "cytokine-mediated signaling pathway", "id": "GO:0019221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019221", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "regulation of Ras protein signal transduction", "id": "GO:0046578", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046578", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "establishment of localization in cell", "id": "GO:0051649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051649", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "antigen receptor-mediated signaling pathway", "id": "GO:0050851", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050851", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "negative regulation of glucose import", "id": "GO:0046325", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046325", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "signaling adaptor activity", "id": "GO:0035591", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035591", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "SH2 domain binding", "id": "GO:0042169", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042169", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "transmembrane receptor protein tyrosine kinase adaptor activity", "id": "GO:0005068", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005068", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "actin filament", "id": "GO:0005884", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005884", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "stress fiber", "id": "GO:0001725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001725", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" }, { "name": "ruffle", "id": "GO:0001726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001726", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 128, "end_pos": 130, "annotation": "n_glycosylation_sequon" }, { "start_pos": 587, "end_pos": 589, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Tyrosine phosphorylated by JAK2, KIT and other kinases activated by B-cell receptor in response to stimulation with cytokines, IL3, IL5, PDGF, IGF1, IGF2, CSF2/GM-CSF and cross-linking of the B-cell receptor complex.", "evidence": [ { "database": "UniProtKB", "id": "Q9JID9", "url": "https://www.uniprot.org/uniprot/Q9JID9" }, { "database": "PubMed", "id": "10872802", "url": "https://glygen.org/publication/PubMed/10872802" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }