{ "uniprot_canonical_ac": "Q9HCQ7-1", "uniprot_ac": "Q9HCQ7", "uniprot_id": "NPVF_HUMAN", "mass": { "chemical_mass": 22327.0, "monoisotopic_mass": 22327.0 }, "refseq": { "ac": "NP_071433", "name": "pro-FMRFamide-related neuropeptide VF precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433" }, "gene_names": [ { "name": "NPVF", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9HCQ7", "id": "Q9HCQ7" }, { "name": "C7orf9; RFRP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433", "id": "NP_071433" }, { "name": "C7orf9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9HCQ7", "id": "Q9HCQ7" }, { "name": "NPVF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433", "id": "NP_071433" }, { "name": "RFRP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9HCQ7", "id": "Q9HCQ7" } ], "protein_names": [ { "name": "Pro-FMRFamide-related neuropeptide VF", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9HCQ7" }, { "name": "Neuropeptide RFRP-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9HCQ7" }, { "name": "RFamide-related peptide; neuropeptide NPVF; FMRFamide-related peptides; pro-FMRFamide-related neuropeptide VF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433", "id": "NP_071433" }, { "name": "pro-FMRFamide-related neuropeptide VF precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433", "id": "NP_071433" } ], "function": [ { "annotation": "GnIH homologs in the human hypothalamus and were identified and human GnIH receptor (GPR147) mRNA expression in the hypothalamus as well as in the pituitary, was characterized. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_071433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433" }, { "database": "PubMed", "id": "20027225", "url": "https://glygen.org/publication/PubMed/20027225" } ] }, { "annotation": "Neuropeptide RFRP-1 acts as a potent negative regulator of gonadotropin synthesis and secretion. Neuropeptides NPSF and NPVF efficiently inhibit forskolin-induced production of cAMP, but RFRP-2 shows no inhibitory activity. Neuropeptide RFRP-1 induces secretion of prolactin in rats. Neuropeptide NPVF blocks morphine-induced analgesia.", "evidence": [ { "database": "UniProtKB", "id": "Q9HCQ7", "url": "https://www.uniprot.org/uniprot/Q9HCQ7#function" }, { "database": "PubMed", "id": "20027225", "url": "https://glygen.org/publication/PubMed/20027225" }, { "database": "PubMed", "id": "11025660", "url": "https://glygen.org/publication/PubMed/11025660" } ] }, { "annotation": "RFRP-3/GPR147 may play secondary, modulatory roles on the regulation of pubertal development; a restraining modulatory effect of the NPVF p.I71_K72 variant on the activation of the gonadotrophic axis cannot be ruled out", "evidence": [ { "database": "RefSeq", "id": "NP_071433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433" }, { "database": "PubMed", "id": "25180599", "url": "https://glygen.org/publication/PubMed/25180599" } ] }, { "annotation": "The distribution of Neuropeptide FF and Neuropeptide VF in central and peripheral tissues and their role in energy homeostasis control. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_071433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433" }, { "database": "PubMed", "id": "34534716", "url": "https://glygen.org/publication/PubMed/34534716" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "26.13", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000105954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105954" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000105954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105954" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000105954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105954" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000105954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105954" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000105954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105954" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "26.53", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000105954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105954" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "18.06", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000105954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105954" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "21.77", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000105954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105954" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "14.41", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000105954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105954" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "20.94", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000105954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105954" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "Q9HCQ7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9HCQ7" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "Q9HCQ7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9HCQ7" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "Q9HCQ7", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/Q9HCQ7" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9HCQ7", "url": "https://www.uniprot.org/uniprot/Q9HCQ7" } ], "common_name": "Human" } ], "gene": [ { "name": "NPVF", "url": "https://www.uniprot.org/uniprot/Q9HCQ7", "locus": { "chromosome": "7", "start_pos": 25224570, "end_pos": 25228486, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000105954", "url": "https://www.ensembl.org/id/ENSG00000105954" } ] } } ], "crossref": [ { "id": "ENSG00000105954", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000105954", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "NPVF", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NPVF", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "64111", "url": "https://www.ncbi.nlm.nih.gov/gene/64111", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "13782", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=13782", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "Q9HCQ7", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9HCQ7*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR026297", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026297", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:64111", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:64111", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "616984", "url": "http://www.omim.org/entry/616984", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_Q9HCQ7", "url": "https://www.nextprot.org/entry/NX_Q9HCQ7", "database": "neXtProt", "categories": [ "Organism-specific", "Protein" ] }, { "id": "KMPHSVA", "url": "https://omabrowser.org/oma/group/KMPHSVA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4369506at2759", "url": "http://www.orthodb.org/?query=4369506at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14403", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14403", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14403:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14403:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "Q9HCQ7", "url": "https://pharos.nih.gov/targets/Q9HCQ7", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_Q9HCQ7", "url": "http://purl.obolibrary.org/obo/PR_Q9HCQ7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_071433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9HCQ7", "url": "https://www.uniprot.org/uniprot/Q9HCQ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9HCQ7-1", "url": "https://www.uniprot.org/uniprot/Q9HCQ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9HCQ7-2", "url": "https://www.uniprot.org/uniprot/Q9HCQ7-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEIISSKLFILLTLATSSLLTSNIFCADELVMSNLHSKENYDKYSEPRGYPKGERSLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRFGRNVQEERSAGATANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQKQSRRLLFKKIDDAELKQEK", "length": 196, "header": "sp|Q9HCQ7-1|NPVF_HUMAN Isoform 1 of Pro-FMRFamide-related neuropeptide VF OS=Homo sapiens OX=9606 GN=NPVF PE=1 SV=3 CANONICAL=Q9HCQ7-1" }, "isoforms": [ { "isoform_ac": "Q9HCQ7-1", "url": "", "sequence": { "sequence": "MEIISSKLFILLTLATSSLLTSNIFCADELVMSNLHSKENYDKYSEPRGYPKGERSLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRFGRNVQEERSAGATANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQKQSRRLLFKKIDDAELKQEK", "length": 196, "header": "sp|Q9HCQ7-1|NPVF_HUMAN Isoform 1 of Pro-FMRFamide-related neuropeptide VF OS=Homo sapiens OX=9606 GN=NPVF PE=1 SV=3 CANONICAL=Q9HCQ7-1" }, "locus": { "chromosome": "7", "start_pos": 25228439, "end_pos": 25225125, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000222674.2", "url": "https://www.ensembl.org/id/ENST00000222674.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000222674.2", "url": "https://www.ensembl.org/id/ENSP00000222674.2" } ] } }, { "isoform_ac": "Q9HCQ7-2", "url": "", "sequence": { "sequence": "MEIISSKLFILLTLATSSLLTSNIFCADELVMSNLHSKENYDKYSEPRGYPKGERSLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRFGRNVQEERSAGATANLPLRSGRNMEVSLVRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQKQSR", "length": 180, "header": "sp|Q9HCQ7-2|NPVF_HUMAN Isoform 2 of Pro-FMRFamide-related neuropeptide VF OS=Homo sapiens OX=9606 GN=NPVF PE=1 SV=3 CANONICAL=Q9HCQ7-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "New neuropeptides containing carboxy-terminal RFamide and their receptor in mammals.", "journal": "Nat. Cell Biol.", "date": "2000", "authors": "Hinuma S, Shintani Y, Fukusumi S, Iijima N, Matsumoto Y, Hosoya M, Fujii R, Watanabe T, Kikuchi K, Terao Y, Yano T, Yamamoto T, Kawamata Y, Habata Y, Asada M, Kitada C, Kurokawa T, Onda H, Nishimura O, Tanaka M, Ibata Y, Fujino M", "evidence": [ { "database": "UniProtKB", "id": "Q9HCQ7", "url": "https://www.uniprot.org/uniprot/Q9HCQ7" } ], "reference": [ { "type": "PubMed", "id": "11025660", "url": "https://glygen.org/publication/PubMed/11025660" } ] }, { "title": "Identification and characterization of novel mammalian neuropeptide FF-like peptides that attenuate morphine-induced antinociception.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Liu Q, Guan XM, Martin WJ, McDonald TP, Clements MK, Jiang Q, Zeng Z, Jacobson M, Williams DL Jr, Yu H, Bomford D, Figueroa D, Mallee J, Wang R, Evans J, Gould R, Austin CP", "evidence": [ { "database": "UniProtKB", "id": "Q9HCQ7", "url": "https://www.uniprot.org/uniprot/Q9HCQ7" } ], "reference": [ { "type": "PubMed", "id": "11481330", "url": "https://glygen.org/publication/PubMed/11481330" } ] }, { "title": "Genomic structure and assessment of the retinally expressed RFamide-related peptide gene in dominant cystoid macular dystrophy.", "journal": "Mol. Vis.", "date": "2002", "authors": "Hoyng C.B., Stoehr H., Weber B.H.F., White K., van Driel M.A., Schulz H.L., Cremers F.", "evidence": [ { "database": "UniProtKB", "id": "Q9HCQ7", "url": "https://www.uniprot.org/uniprot/Q9HCQ7" } ], "reference": [ { "type": "PubMed", "id": "11951088", "url": "https://glygen.org/publication/PubMed/11951088" } ] }, { "title": "Identification of human GnIH homologs, RFRP-1 and RFRP-3, and the cognate receptor, GPR147 in the human hypothalamic pituitary axis.", "journal": "PLoS ONE", "date": "2009", "authors": "Ubuka T, Morgan K, Pawson AJ, Osugi T, Chowdhury VS, Minakata H, Tsutsui K, Millar RP, Bentley GE", "evidence": [ { "database": "UniProtKB", "id": "Q9HCQ7", "url": "https://www.uniprot.org/uniprot/Q9HCQ7" }, { "database": "RefSeq", "id": "NP_071433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433" } ], "reference": [ { "type": "PubMed", "id": "20027225", "url": "https://glygen.org/publication/PubMed/20027225" } ] }, { "title": "Mutational analysis of the genes encoding RFamide-related peptide-3, the human orthologue of gonadotrophin-inhibitory hormone, and its receptor (GPR147) in patients with gonadotrophin-releasing hormone-dependent pubertal disorders.", "journal": "Journal of neuroendocrinology", "date": "2014", "authors": "Lima CJ, Cardoso SC, Lemos EF, Zingler E, Capanema C, Menezes LD, Vogado G, Dos Santos BT, de Moraes OL, Duarte EF, de Brito VN, Latronico AC, Lofrano-Porto A", "evidence": [ { "database": "RefSeq", "id": "NP_071433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433" } ], "reference": [ { "type": "PubMed", "id": "25180599", "url": "https://glygen.org/publication/PubMed/25180599" } ] }, { "title": "The distribution of Neuropeptide FF and Neuropeptide VF in central and peripheral tissues and their role in energy homeostasis control.", "journal": "Neuropeptides", "date": "2021", "authors": "Koller J, Herzog H, Zhang L", "evidence": [ { "database": "RefSeq", "id": "NP_071433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071433" } ], "reference": [ { "type": "PubMed", "id": "34534716", "url": "https://glygen.org/publication/PubMed/34534716" } ] } ], "pathway": [ { "id": "hsa:64111", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:64111", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9ESQ8-1", "protein_name": "Pro-FMRFamide-related neuropeptide VF", "gene_name": "Npvf", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEIISLKRFILLTVATSSFLTSNTFCTDEFMMPHFHSKEGDGKYSQLRGIPKGEKERSVSFQELKDWGAKNVIKMSPAPANKVPHSAANLPLRFGRTIDEKRSPAARVNMEAGTRSHFPSLPQRFGRTTARSPKTPADLPQKPLHSLGSSELLYVMICQHQEIQSPGGKRTRRGAFVETDDAERKPEK", "length": 188 }, "evidence": [ { "id": "45229410", "url": "http://www.informatics.jax.org/homology/45229410", "database": "MGI" }, { "id": "Q9HCQ7", "url": "https://omabrowser.org/oma/group/Q9HCQ7/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9ESQ9-1", "protein_name": "Pro-FMRFamide-related neuropeptide VF", "gene_name": "Npvf", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEIISSKRFILLTLATSSFLTSNTLCSDELMMPHFHSKEGYGKYYQLRGIPKGVKERSVTFQELKDWGAKKDIKMSPAPANKVPHSAANLPLRFGRNIEDRRSPRARANMEAGTMSHFPSLPQRFGRTTARRITKTLAGLPQKSLHSLASSELLYAMTRQHQEIQSPGQEQPRKRVFTETDDAERKQEKIGNLQPVLQGAMKL", "length": 203 }, "evidence": [ { "id": "45229410", "url": "http://www.informatics.jax.org/homology/45229410", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "Q9HCQ7", "url": "https://www.uniprot.org/uniprot/Q9HCQ7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q9HCQ7", "url": "https://www.uniprot.org/uniprot/Q9HCQ7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "neuropeptide signaling pathway", "id": "GO:0007218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007218", "evidence": [ { "database": "UniProtKB", "id": "Q9HCQ7", "url": "https://www.uniprot.org/uniprot/Q9HCQ7" } ], "pmid": "" }, { "name": "negative regulation of gonadotropin secretion", "id": "GO:0032277", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032277", "evidence": [ { "database": "UniProtKB", "id": "Q9HCQ7", "url": "https://www.uniprot.org/uniprot/Q9HCQ7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }