{ "uniprot_canonical_ac": "Q9EQL9-1", "uniprot_ac": "Q9EQL9", "uniprot_id": "SHRPN_RAT", "mass": { "chemical_mass": 40287.0, "monoisotopic_mass": 40287.0 }, "refseq": { "ac": "NP_112415", "name": "sharpin", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112415" }, "gene_names": [ { "name": "Sharpin", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9EQL9", "id": "Q9EQL9" }, { "name": "Conneck1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112415", "id": "NP_112415" }, { "name": "Sharpin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112415", "id": "NP_112415" } ], "protein_names": [ { "name": "Sharpin", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9EQL9" }, { "name": "Shank-associated RH domain-interacting protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9EQL9" }, { "name": "shank-associated RH domain-interacting protein; shank-interacting protein; SHANK-associated RH domain interacting protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112415", "id": "NP_112415" }, { "name": "sharpin", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112415", "id": "NP_112415" } ], "function": [ { "annotation": "Component of the LUBAC complex which conjugates linear polyubiquitin chains in a head-to-tail manner to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation. LUBAC conjugates linear polyubiquitin to IKBKG and RIPK1 and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. Linear ubiquitination mediated by the LUBAC complex interferes with TNF-induced cell death and thereby prevents inflammation. LUBAC is recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. The LUBAC complex is also involved in innate immunity by conjugating linear polyubiquitin chains at the surface of bacteria invading the cytosol to form the ubiquitin coat surrounding bacteria. LUBAC is not able to initiate formation of the bacterial ubiquitin coat, and can only promote formation of linear polyubiquitins on pre-existing ubiquitin. The bacterial ubiquitin coat acts as an 'eat-me' signal for xenophagy and promotes NF-kappa-B activation. Together with OTULIN, the LUBAC complex regulates the canonical Wnt signaling during angiogenesis.", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9#function" }, { "database": "UniProtKB", "id": "Q9H0F6", "url": "https://www.uniprot.org/uniprot/Q9H0F6#function" } ] }, { "annotation": "The upregulation of Shank-interacting protein-like 1 (SIPL1) in the fundus of W/WV mice, and expression in the upper gastrointestinal tract suggest that the SIPL1 gene could be associated with interstitial cells of Cajal (ICC) function in mice and humans.", "evidence": [ { "database": "RefSeq", "id": "NP_112415", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112415" }, { "database": "PubMed", "id": "12753155", "url": "https://glygen.org/publication/PubMed/12753155" } ] } ], "disease": [ { "disease_id": "DOID:3310", "recommended_name": { "id": "DOID:3310", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3310", "name": "atopic dermatitis", "description": "An allergic contact dermatitis that is a chronically relapsing inflammatory allergic response located_in the skin that causes itching and flaking." }, "synonyms": [ { "id": "DOID:3310", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3310", "name": "Atopic neurodermatitis", "description": "" }, { "id": "DOID:3310", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3310", "name": "Besnier's prurigo", "description": "" }, { "id": "DOID:3310", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3310", "name": "allergic dermatitis", "description": "" }, { "id": "DOID:3310", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3310", "name": "atopic eczema", "description": "" }, { "id": "MONDO:0011292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011292", "name": "dermatitis, atopic", "description": "" }, { "id": "MONDO:0011292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011292", "name": "ATOD", "description": "" }, { "id": "MONDO:0011292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011292", "name": "dermatitis, atopic", "description": "" }, { "id": "MONDO:0011292", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011292", "name": "eczema, atopic", "description": "" } ], "evidence": [ { "id": "3310", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3310" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "common_name": "Rat" } ], "gene": [ { "name": "Sharpin", "url": "https://www.uniprot.org/uniprot/Q9EQL9", "locus": { "chromosome": "7", "start_pos": 108070687, "end_pos": 108074955, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000012812", "url": "https://www.ensembl.org/id/ENSRNOG00000012812" } ] } } ], "crossref": [ { "id": "ENSRNOG00000012812", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000012812", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd01799", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01799", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "81859", "url": "https://www.ncbi.nlm.nih.gov/gene/81859", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9EQL9", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9EQL9*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001876", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001876", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011993", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011993", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029071", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029071", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031912", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031912", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036443", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036443", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:81859", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:81859", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SCTFINV", "url": "https://omabrowser.org/oma/group/SCTFINV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2903477at2759", "url": "http://www.orthodb.org/?query=2903477at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22770", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22770", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22770:SF43", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22770:SF43", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF16764", "url": "http://pfam.xfam.org/family/PF16764", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9EQL9", "url": "http://purl.obolibrary.org/obo/PR_Q9EQL9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-5357786", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5357786", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5357905", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5357905", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-5357956", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5357956", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_112415", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112415", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "631353", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=631353", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9EQL9-1", "url": "https://www.uniprot.org/uniprot/Q9EQL9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSPPAGGAAAAADPASPVVLLAVQAAVRLLGAGHEDEAQLRKLQLKADPERPGRFRLGLLGIEPGAVSLEWPLESICYTIRGPNQHELQPPPGGPGTFSVHFLNSEEAQQWAALVRDATAEGQNGNDSTAPVPTPAMCPTSPPCSSVTPTPKATQPEMDLPQGSGNLKKEELATHLAQAIAGGDEKAAAQVAAILAQHHVALNVQLLEAWFPRGPIRLQVTVEDATSVLSSSSSAHVSLQIHPHCSIAALQEQVFSEFGFPPAVQRWVIGRCLCMPERSLASYGVSQDGDPAFLYLLSAPREVSGHSPQHSKMDRKLGCLFPQSLELPHNLQASSSSLPSPPQPGWSCPSCTFINASNRPGCEMCSTQRPCAWDPLTATST", "length": 381, "header": "sp|Q9EQL9-1|SHRPN_RAT Isoform 1 of Sharpin OS=Rattus norvegicus OX=10116 GN=Sharpin PE=1 SV=1 CANONICAL=Q9EQL9-1" }, "isoforms": [ { "isoform_ac": "Q9EQL9-1", "url": "", "sequence": { "sequence": "MSPPAGGAAAAADPASPVVLLAVQAAVRLLGAGHEDEAQLRKLQLKADPERPGRFRLGLLGIEPGAVSLEWPLESICYTIRGPNQHELQPPPGGPGTFSVHFLNSEEAQQWAALVRDATAEGQNGNDSTAPVPTPAMCPTSPPCSSVTPTPKATQPEMDLPQGSGNLKKEELATHLAQAIAGGDEKAAAQVAAILAQHHVALNVQLLEAWFPRGPIRLQVTVEDATSVLSSSSSAHVSLQIHPHCSIAALQEQVFSEFGFPPAVQRWVIGRCLCMPERSLASYGVSQDGDPAFLYLLSAPREVSGHSPQHSKMDRKLGCLFPQSLELPHNLQASSSSLPSPPQPGWSCPSCTFINASNRPGCEMCSTQRPCAWDPLTATST", "length": 381, "header": "sp|Q9EQL9-1|SHRPN_RAT Isoform 1 of Sharpin OS=Rattus norvegicus OX=10116 GN=Sharpin PE=1 SV=1 CANONICAL=Q9EQL9-1" }, "locus": { "chromosome": "7", "start_pos": 108074548, "end_pos": 108070904, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000018031", "url": "https://www.ensembl.org/id/ENSRNOT00000018031" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000018032", "url": "https://www.ensembl.org/id/ENSRNOP00000018032" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 307, "end_pos": 307, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "site_lbl": "Ser307" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Sharpin, a novel postsynaptic density protein that directly interacts with the shank family of proteins.", "journal": "Mol. Cell. Neurosci.", "date": "2001", "authors": "Lim S, Sala C, Yoon J, Park S, Kuroda S, Sheng M, Kim E", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "reference": [ { "type": "PubMed", "id": "11178875", "url": "https://glygen.org/publication/PubMed/11178875" } ] }, { "title": "Novel human and mouse genes encoding a shank-interacting protein and its upregulation in gastric fundus of W/WV mouse.", "journal": "Journal of gastroenterology and hepatology", "date": "2003", "authors": "Daigo Y, Takayama I, Ward SM, Sanders KM, Fujino MA", "evidence": [ { "database": "RefSeq", "id": "NP_112415", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112415" } ], "reference": [ { "type": "PubMed", "id": "12753155", "url": "https://glygen.org/publication/PubMed/12753155" } ] }, { "title": "SHANK3 gene mutations associated with autism facilitate ligand binding to the Shank3 ankyrin repeat region.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Mameza MG, Dvoretskova E, Bamann M, Honck HH, Guler T, Boeckers TM, Schoen M, Verpelli C, Sala C, Barsukov I, Dityatev A, Kreienkamp HJ", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "reference": [ { "type": "PubMed", "id": "23897824", "url": "https://glygen.org/publication/PubMed/23897824" } ] } ], "pathway": [ { "id": "rno:81859", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:81859", "resource": "KEGG Pathway" }, { "id": "R-RNO-5357786", "name": "TNFR1-induced proapoptotic signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5357786", "resource": "Reactome", "description": "TNFR1-induced proapoptotic signaling" }, { "id": "R-RNO-5357905", "name": "Regulation of TNFR1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5357905", "resource": "Reactome", "description": "Regulation of TNFR1 signaling" }, { "id": "R-RNO-5357956", "name": "TNFR1-induced NF-kappa-B signaling pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-5357956", "resource": "Reactome", "description": "TNFR1-induced NF-kappa-B signaling pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q91WA6-1", "protein_name": "Sharpin", "gene_name": "Sharpin", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSPPAGGAAVAADPASPVVLLAVHAAVRPLGAGQDAEAQPRKLQLIADPERPGRFRLGLLGTEPGAVSLEWPLEAICYTVRGPNQHELQPPPGGPGTFSVHFLDPEEAQQWAALVRDATAEGQNGSGSPAPAPAPAMCPISPPCSSMAQIPKATQPEVDLPQSSGNFKKEELATRLSQAIAGGDEKAAAQVAAVLAQHHVALNVQLMEAWFPPGPIRLQVTVEDATSVLSSSSSAHVSLKIHPHCSIAALQDQVFSEFGFPPAVQRWVIGRCLCMPERSLASYGVSQDGDPAFLYLLSAPREVSGQSLQNSKMDRKLGLFPQSLGLPHDLQPSSSSLPSPSQPGWSCPSCTFINASNRPGCEMCSTQRPCAWDPLAAAST", "length": 380 }, "evidence": [ { "id": "45230648", "url": "http://www.informatics.jax.org/homology/45230648", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9H0F6-1", "protein_name": "Sharpin", "gene_name": "SHARPIN", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLELLGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGATVEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASAASSAHVALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLLSAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQPSWSCPSCTFINAPDRPGCEMCSTQRPCTWDPLAAAST", "length": 387 }, "evidence": [ { "id": "45230648", "url": "http://www.informatics.jax.org/homology/45230648", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "protein linear polyubiquitination", "id": "GO:0097039", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097039", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "regulation of CD40 signaling pathway", "id": "GO:2000348", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000348", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "keratinization", "id": "GO:0031424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031424", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "epidermis development", "id": "GO:0008544", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008544", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "negative regulation of inflammatory response", "id": "GO:0050728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050728", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "positive regulation of I-kappaB kinase/NF-kappaB signaling", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "mitochondrion organization", "id": "GO:0007005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007005", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "apoptotic nuclear changes", "id": "GO:0030262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030262", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "regulation of tumor necrosis factor-mediated signaling pathway", "id": "GO:0010803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010803", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "LUBAC complex", "id": "GO:0071797", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071797", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "polyubiquitin modification-dependent protein binding", "id": "GO:0031593", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031593", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "ubiquitin-protein transferase activity", "id": "GO:0004842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004842", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" }, { "name": "ubiquitin binding", "id": "GO:0043130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043130", "evidence": [ { "database": "UniProtKB", "id": "Q9EQL9", "url": "https://www.uniprot.org/uniprot/Q9EQL9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 126, "end_pos": 128, "annotation": "n_glycosylation_sequon" }, { "start_pos": 355, "end_pos": 357, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }