{
    "uniprot_canonical_ac": "Q9EQH4-1",
    "uniprot_ac": "Q9EQH4",
    "uniprot_id": "TAF8_MOUSE",
    "mass": {
        "chemical_mass": 33988.0,
        "monoisotopic_mass": 33988.0
    },
    "refseq": {
        "ac": "NP_071298",
        "name": "transcription initiation factor TFIID subunit 8 isoform 1",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298"
    },
    "gene_names": [
        {
            "name": "Taf8",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9EQH4",
            "id": "Q9EQH4"
        },
        {
            "name": "Taf8",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298",
            "id": "NP_071298"
        },
        {
            "name": "Tbn",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298",
            "id": "NP_071298"
        },
        {
            "name": "Tbn",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9EQH4",
            "id": "Q9EQH4"
        }
    ],
    "protein_names": [
        {
            "name": "Transcription initiation factor TFIID subunit 8",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9EQH4"
        },
        {
            "name": "Protein taube nuss",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9EQH4"
        },
        {
            "name": "TBP-associated factor 8",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9EQH4"
        },
        {
            "name": "transcription initiation factor TFIID subunit 8 isoform 1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298",
            "id": "NP_071298"
        },
        {
            "name": "transcription initiation factor TFIID subunit 8; protein taube nuss; TBP-associated factor 8",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298",
            "id": "NP_071298"
        }
    ],
    "function": [
        {
            "annotation": "In contrast, loss of TAF8 in mouse embryonic stem cells and blastocysts leads to cell death and to a global decrease in Pol II transcription",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_071298",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298"
                },
                {
                    "database": "PubMed",
                    "id": "29648665",
                    "url": "https://glygen.org/publication/PubMed/29648665"
                }
            ]
        },
        {
            "annotation": "Loss of TAF8 causes TFIID dysfunction and p53-mediated apoptotic neuronal cell death.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_071298",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298"
                },
                {
                    "database": "PubMed",
                    "id": "35361962",
                    "url": "https://glygen.org/publication/PubMed/35361962"
                }
            ]
        },
        {
            "annotation": "TAF8 regions important for TFIID lobe B assembly or for TAF2 interactions are required for embryonic stem cell survival.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_071298",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298"
                },
                {
                    "database": "PubMed",
                    "id": "34634302",
                    "url": "https://glygen.org/publication/PubMed/34634302"
                }
            ]
        },
        {
            "annotation": "The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (By similarity). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC) (By similarity). The TFIID complex consists of TBP and TBP-associated factors (TAFs), including TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13 (By similarity). The TFIID complex structure can be divided into 3 modules TFIID-A, TFIID-B, and TFIID-C (By similarity). TAF8 is involved in forming the TFIID-B module, together with TAF5 (By similarity). Mediates both basal and activator-dependent transcription (By similarity). Plays a role in the differentiation of preadipocyte fibroblasts to adipocytes, however, does not seem to play a role in differentiation of myoblasts (PubMed:14580349). Required for the integration of TAF10 in the TAF complex (By similarity). May be important for survival of cells of the inner cell mass which constitute the pluripotent cell population of the early embryo (PubMed:11076765).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9EQH4",
                    "url": "https://www.uniprot.org/uniprot/Q9EQH4#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q7Z7C8",
                    "url": "https://www.uniprot.org/uniprot/Q7Z7C8#function"
                },
                {
                    "database": "PubMed",
                    "id": "14580349",
                    "url": "https://glygen.org/publication/PubMed/14580349"
                },
                {
                    "database": "PubMed",
                    "id": "11076765",
                    "url": "https://glygen.org/publication/PubMed/11076765"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9EQH4",
                    "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Taf8",
            "url": "https://www.uniprot.org/uniprot/Q9EQH4",
            "locus": {
                "chromosome": "17",
                "start_pos": 47794289,
                "end_pos": 47813217,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000023980",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000023980"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000023980",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000023980",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "cd08049",
            "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08049",
            "database": "CDD",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "63856",
            "url": "https://www.ncbi.nlm.nih.gov/gene/63856",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR006565",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR006565",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR009072",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR019473",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR019473",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR037818",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR037818",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:63856",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:63856",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1926879",
            "url": "http://www.informatics.jax.org/marker/MGI:1926879",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "SAHNYCE",
            "url": "https://omabrowser.org/oma/group/SAHNYCE/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5483295at2759",
            "url": "http://www.orthodb.org/?query=5483295at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR46469",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46469",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR46469:SF1",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46469:SF1",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF07524",
            "url": "http://pfam.xfam.org/family/PF07524",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF10406",
            "url": "http://pfam.xfam.org/family/PF10406",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q9EQH4",
            "url": "http://purl.obolibrary.org/obo/PR_Q9EQH4",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-6807505",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6807505",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_071298",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9EQH4",
            "url": "https://www.uniprot.org/uniprot/Q9EQH4",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9EQH4-1",
            "url": "https://www.uniprot.org/uniprot/Q9EQH4-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9EQH4-2",
            "url": "https://www.uniprot.org/uniprot/Q9EQH4-2",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9EQH4-3",
            "url": "https://www.uniprot.org/uniprot/Q9EQH4-3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9EQH4-4",
            "url": "https://www.uniprot.org/uniprot/Q9EQH4-4",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9EQH4-5",
            "url": "https://www.uniprot.org/uniprot/Q9EQH4-5",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MADTAAGPGGSGTRPGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQILREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEIQQMEETDSSEQEEQTDTENNALHISTDDSGAEKESASVLQQSSSLSGSRNGEESVIDNPYLRPVKKPKIRRKKSLS",
        "length": 308,
        "header": "sp|Q9EQH4-1|TAF8_MOUSE Isoform 1 of Transcription initiation factor TFIID subunit 8  OS=Mus musculus OX=10090 GN=Taf8 PE=2 SV=1 CANONICAL=Q9EQH4-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q9EQH4-1",
            "url": "",
            "sequence": {
                "sequence": "MADTAAGPGGSGTRPGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQILREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEIQQMEETDSSEQEEQTDTENNALHISTDDSGAEKESASVLQQSSSLSGSRNGEESVIDNPYLRPVKKPKIRRKKSLS",
                "length": 308,
                "header": "sp|Q9EQH4-1|TAF8_MOUSE Isoform 1 of Transcription initiation factor TFIID subunit 8  OS=Mus musculus OX=10090 GN=Taf8 PE=2 SV=1 CANONICAL=Q9EQH4-1"
            },
            "locus": {
                "chromosome": "17",
                "start_pos": 47813194,
                "end_pos": 47800812,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000067103",
                        "url": "https://www.ensembl.org/id/ENSMUST00000067103"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000063201",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000063201"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9EQH4-2",
            "url": "",
            "sequence": {
                "sequence": "MADTAAGPGGSGTRPGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQILREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEIQQMEETDSSEQEEQTDTENNALHISTDDSGAEKESASVLQQSSSLSGSRNGEESVIDNPYLRPVKKPKIRRKK",
                "length": 305,
                "header": "sp|Q9EQH4-2|TAF8_MOUSE Isoform 2 of Transcription initiation factor TFIID subunit 8  OS=Mus musculus OX=10090 GN=Taf8 PE=2 SV=1 CANONICAL=Q9EQH4-1"
            },
            "locus": {
                "chromosome": "17",
                "start_pos": 47813194,
                "end_pos": 47801067,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000233121",
                        "url": "https://www.ensembl.org/id/ENSMUST00000233121"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000156629",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000156629"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9EQH4-3",
            "url": "",
            "sequence": {
                "sequence": "MADTAAGPGGSGTRPGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQILREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEIQQMEETDSSEQEEQTDTENNALHISTGHPEASA",
                "length": 265,
                "header": "sp|Q9EQH4-3|TAF8_MOUSE Isoform 3 of Transcription initiation factor TFIID subunit 8  OS=Mus musculus OX=10090 GN=Taf8 PE=2 SV=1 CANONICAL=Q9EQH4-1"
            },
            "locus": {
                "chromosome": "17",
                "start_pos": 47813194,
                "end_pos": 47794739,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000233174",
                        "url": "https://www.ensembl.org/id/ENSMUST00000233174"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000156668",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000156668"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9EQH4-4",
            "url": "",
            "sequence": {
                "sequence": "MADTAAGPGGSGTRPGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQILREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEIQQMEETDSSEQEEQTDTENNALHISTVGPPLLPASQQSQNSLSHILPLPLGTEQGLPQVSGWLLQACMMGCVSSLHHETHLLGSHTFSRW",
                "length": 322,
                "header": "sp|Q9EQH4-4|TAF8_MOUSE Isoform 4 of Transcription initiation factor TFIID subunit 8  OS=Mus musculus OX=10090 GN=Taf8 PE=2 SV=1 CANONICAL=Q9EQH4-1"
            },
            "locus": {}
        },
        {
            "isoform_ac": "Q9EQH4-5",
            "url": "",
            "sequence": {
                "sequence": "MADTAAGPGGSGTRPGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQILREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLISDQHLIKAP",
                "length": 221,
                "header": "sp|Q9EQH4-5|TAF8_MOUSE Isoform 5 of Transcription initiation factor TFIID subunit 8  OS=Mus musculus OX=10090 GN=Taf8 PE=2 SV=1 CANONICAL=Q9EQH4-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 128,
            "end_pos": 128,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Thr",
            "comment": "Phosphothreonine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9EQH4",
                    "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                }
            ],
            "site_lbl": "Thr128"
        },
        {
            "start_pos": 269,
            "end_pos": 269,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9EQH4",
                    "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                }
            ],
            "site_lbl": "Ser269"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Taube nuss is a novel gene essential for the survival of pluripotent cells of early mouse embryos.",
            "journal": "Development",
            "date": "2000",
            "authors": "Voss AK, Thomas T, Petrou P, Anastassiadis K, Scholer H, Gruss P",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9EQH4",
                    "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "11076765",
                    "url": "https://glygen.org/publication/PubMed/11076765"
                }
            ]
        },
        {
            "title": "The TBN protein, which is essential for early embryonic mouse development, is an inducible TAFII implicated in adipogenesis.",
            "journal": "Mol. Cell",
            "date": "2003",
            "authors": "Guermah M, Ge K, Chiang CM, Roeder RG",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9EQH4",
                    "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14580349",
                    "url": "https://glygen.org/publication/PubMed/14580349"
                }
            ]
        },
        {
            "title": "Homozygous TAF8 mutation in a patient with intellectual disability results in undetectable TAF8 protein, but preserved RNA polymerase II transcription.",
            "journal": "Human molecular genetics",
            "date": "2018",
            "authors": "El-Saafin F, Curry C, Ye T, Garnier JM, Kolb-Cheynel I, Stierle M, Downer NL, Dixon MP, Negroni L, Berger I, Thomas T, Voss AK, Dobyns W, Devys D, Tora L",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_071298",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "29648665",
                    "url": "https://glygen.org/publication/PubMed/29648665"
                }
            ]
        },
        {
            "title": "TAF8 regions important for TFIID lobe B assembly or for TAF2 interactions are required for embryonic stem cell survival.",
            "journal": "The Journal of biological chemistry",
            "date": "2021",
            "authors": "Scheer E, Luo J, Bernardini A, Ruffenach F, Garnier JM, Kolb-Cheynel I, Gupta K, Berger I, Ranish J, Tora L",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_071298",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34634302",
                    "url": "https://glygen.org/publication/PubMed/34634302"
                }
            ]
        },
        {
            "title": "Loss of TAF8 causes TFIID dysfunction and p53-mediated apoptotic neuronal cell death.",
            "journal": "Cell death and differentiation",
            "date": "2022",
            "authors": "El-Saafin F, Bergamasco MI, Chen Y, May RE, Esakky P, Hediyeh-Zadeh S, Dixon M, Wilcox S, Davis MJ, Strasser A, Smyth GK, Thomas T, Voss AK",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_071298",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_071298"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "35361962",
                    "url": "https://glygen.org/publication/PubMed/35361962"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:63856",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:63856",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-6807505",
            "name": "RNA polymerase II transcribes snRNA genes",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6807505",
            "resource": "Reactome",
            "description": "RNA polymerase II transcribes snRNA genes"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "A0A8I6AWS9-1",
            "protein_name": "Transcription initiation factor TFIID subunit 8",
            "gene_name": "Taf8",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MADTATGPGGSGTRPGNKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEIQQMEETDSSEQDEQTDTENIALHISTDESGAEKENTSVLQQNSSLSGSRNGEESTIDNPYLRPVKKPKIRRKKSLS",
                "length": 308
            },
            "evidence": [
                {
                    "id": "45237096",
                    "url": "http://www.informatics.jax.org/homology/45237096",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q7Z7C8-1",
            "protein_name": "Transcription initiation factor TFIID subunit 8",
            "gene_name": "TAF8",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEETDSSEQDEQTDTENLALHISMEDSGAEKENTSVLQQNPSLSGSRNGEENIIDNPYLRPVKKPKIRRKKSLS",
                "length": 310
            },
            "evidence": [
                {
                    "id": "45237096",
                    "url": "http://www.informatics.jax.org/homology/45237096",
                    "database": "MGI"
                },
                {
                    "id": "Q9EQH4",
                    "url": "https://omabrowser.org/oma/group/Q9EQH4/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q9VWY6-1",
            "protein_name": "Transcription initiation factor TFIID subunit 8",
            "gene_name": "Taf8",
            "tax_id": 7227,
            "organism": "Drosophila melanogaster",
            "sequence": {
                "sequence": "MEKVEAVTVSNVDPYRRILNKVVSQLLLDKGAGQASNHSLETLTQMLQALIWEIGNSAHNYCELSGRTMPTVGDVSLALINMGISISNLDPYMRKETHVPIPLPPQQTQQRPLSLLQAGIKAPHPHYVPSYFPPMPDPHAYIRTPTHKQPVTEYEAIREKAACQKRDIEKALTKFLCKTTETNNLFPTEDNMFPLIACKPAFPPYAAALNPTDQVFDFEELEYHYLVANRTEDEPSKDDGEEGDSENEEMDGDKSKEEKPELDIKPNSNTNKAILENPNIDNPYLRAATLPKRSKNCPTPGTMPSRSLATTAPTIRTPSTLEITKTNL",
                "length": 328
            },
            "evidence": [
                {
                    "id": "Q9EQH4",
                    "url": "https://omabrowser.org/oma/group/Q9EQH4/",
                    "database": "OMA"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 10,
                "go_terms": [
                    {
                        "name": "positive regulation of transcription initiation by RNA polymerase II",
                        "id": "GO:0060261",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060261",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein phosphorylation",
                        "id": "GO:0006468",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cell differentiation",
                        "id": "GO:0030154",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "transcription initiation at RNA polymerase II promoter",
                        "id": "GO:0006367",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006367",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mRNA transcription by RNA polymerase II",
                        "id": "GO:0042789",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042789",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "maintenance of protein location in nucleus",
                        "id": "GO:0051457",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051457",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of fat cell differentiation",
                        "id": "GO:0045598",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045598",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "inner cell mass cell proliferation",
                        "id": "GO:0001833",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001833",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "RNA polymerase II preinitiation complex assembly",
                        "id": "GO:0051123",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051123",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "DNA-templated transcription open complex formation",
                        "id": "GO:0001112",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001112",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 4,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nucleoplasm",
                        "id": "GO:0005654",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "perinuclear region of cytoplasm",
                        "id": "GO:0048471",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "transcription factor TFIID complex",
                        "id": "GO:0005669",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005669",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "protein heterodimerization activity",
                        "id": "GO:0046982",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9EQH4",
                                "url": "https://www.uniprot.org/uniprot/Q9EQH4"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                },
                {
                    "field": "total_sites",
                    "count": 2
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 5
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}