{ "uniprot_canonical_ac": "Q9EP75-1", "uniprot_ac": "Q9EP75", "uniprot_id": "CP4FE_MOUSE", "mass": { "chemical_mass": 59800.0, "monoisotopic_mass": 59800.0 }, "refseq": { "ac": "NP_001191262", "name": "leukotriene-B4 omega-hydroxylase 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262" }, "gene_names": [ { "name": "Cyp4f14", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9EP75", "id": "Q9EP75" }, { "name": "1300014O15Rik; cyp4f-14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262", "id": "NP_001191262" }, { "name": "Cyp4f14", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262", "id": "NP_001191262" } ], "protein_names": [ { "name": "Leukotriene-B4 omega-hydroxylase 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9EP75" }, { "name": "1.14.14.94", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9EP75" }, { "name": "Cyp4f-14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9EP75" }, { "name": "Cytochrome P450 4F14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9EP75" }, { "name": "Cytochrome P450-LTB-omega", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9EP75" }, { "name": "Leukotriene-B4 20-monooxygenase 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9EP75" }, { "name": "cytochrome P450 4F14; cytochrome P450-LTB-omega; leukotriene-B4 20-monooxygenase 3; cytochrome P450, subfamily IVF, polypeptide 14 (leukotriene B4 omega hydroxylase)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262", "id": "NP_001191262" }, { "name": "leukotriene-B4 omega-hydroxylase 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262", "id": "NP_001191262" } ], "function": [ { "annotation": "CYP4F14 is the major but not the only vitamin E-omega-hydroxylase in mice", "evidence": [ { "database": "RefSeq", "id": "NP_001191262", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262" }, { "database": "PubMed", "id": "22665481", "url": "https://glygen.org/publication/PubMed/22665481" } ] }, { "annotation": "Catalytic activity of Cyp4fs is a novel target for modulating neuroinflammation through hydroxylation of LTB(4).", "evidence": [ { "database": "RefSeq", "id": "NP_001191262", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262" }, { "database": "PubMed", "id": "21466787", "url": "https://glygen.org/publication/PubMed/21466787" } ] }, { "annotation": "Cytochromes P450 are a group of heme-thiolate monooxygenases. Catalyzes the omega-hydroxylation of LTB4 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75#function" } ] }, { "annotation": "THE TOH-omega-hydroxylase activity was exhibited by microsomes from mouse and human small intestine; murine activity was entirely due to CYP4F14.", "evidence": [ { "database": "RefSeq", "id": "NP_001191262", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262" }, { "database": "PubMed", "id": "22969154", "url": "https://glygen.org/publication/PubMed/22969154" } ] }, { "annotation": "The data suggested that, in the absence of A2A adenosine receptor, omega-hydroxylase induces vasoconstriction through mitogen-activated protein kinases via upregulation of adenosine A1 receptor and protein kinase C-alpha.", "evidence": [ { "database": "RefSeq", "id": "NP_001191262", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262" }, { "database": "PubMed", "id": "22160543", "url": "https://glygen.org/publication/PubMed/22160543" } ] } ], "disease": [ { "disease_id": "DOID:0050861", "recommended_name": { "id": "DOID:0050861", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050861", "name": "colorectal adenocarcinoma", "description": "A colorectal carcinoma that derives_from epithelial cells of glandular origin." }, "synonyms": [], "evidence": [ { "id": "0050861", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050861" } ] }, { "disease_id": "DOID:10763", "recommended_name": { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hypertension", "description": "An artery disease characterized by chronic elevated blood pressure in the arteries." }, "synonyms": [ { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "HTN", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "hyperpiesia", "description": "" }, { "id": "DOID:10763", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10763", "name": "vascular hypertensive disorder", "description": "" } ], "evidence": [ { "id": "10763", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:10763" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cyp4f14", "url": "https://www.uniprot.org/uniprot/Q9EP75", "locus": { "chromosome": "17", "start_pos": 33124044, "end_pos": 33136316, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000024292", "url": "https://www.ensembl.org/id/ENSMUSG00000024292" } ] } } ], "crossref": [ { "id": "ENSMUSG00000024292", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000024292", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.14.14.94", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.14.94&UniProtAcc=Q9EP75", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd20679", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20679", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "64385", "url": "https://www.ncbi.nlm.nih.gov/gene/64385", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001128", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001128", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002401", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002401", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002402", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002402", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017972", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017972", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036396", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036396", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:64385", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:64385", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1927669", "url": "http://www.informatics.jax.org/marker/MGI:1927669", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "NGVCNEV", "url": "https://omabrowser.org/oma/group/NGVCNEV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1611592at2759", "url": "http://www.orthodb.org/?query=1611592at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24291", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24291", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24291:SF190", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24291:SF190", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00067", "url": "http://pfam.xfam.org/family/PF00067", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9EP75", "url": "http://purl.obolibrary.org/obo/PR_Q9EP75", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-211979", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-211979", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-2142691", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2142691", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001191262", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "22176", "url": "https://www.rhea-db.org/rhea/22176", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A3Q4EC89", "url": "https://www.uniprot.org/uniprot/A0A3Q4EC89", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q4EC89-1", "url": "https://www.uniprot.org/uniprot/A0A3Q4EC89-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q4EHX3", "url": "https://www.uniprot.org/uniprot/A0A3Q4EHX3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q4EHX3-1", "url": "https://www.uniprot.org/uniprot/A0A3Q4EHX3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9EP75-1", "url": "https://www.uniprot.org/uniprot/Q9EP75-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSQLSLSWLGLGPEVAFPWKTLLLLGASWILARILIQIYAAYRNYRHLHGFPQPPKRNWLMGHVGMVTPTEQGLKELTRLVGTYPQGFLMWIGPMVPVITLCHSDIVRSILNASAAVALKDVIFYSILKPWLGDGLLVSAGDKWSRHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWQRLISDGSARLDMFEHVSLMTLDSLQKCVFSFDSNCQEKSSEYIAAILELSALVAKRHQQPLMFMDLLYNLTPDGMRFRKACNVVHEFTDAVIRERHRTLPDQGLDDFLKSKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLARHPEYQERCRQEVQELLRGREPEEIEWDDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGRTIPKGIICLISIFGIHHNPSVWPDPEVYDPFRFDPENIKDSSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRLLPDDKEPRRQPELILRAEGGLWLRVEPLSAGAH", "length": 524, "header": "sp|Q9EP75-1|CP4FE_MOUSE Isoform 1 of Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus OX=10090 GN=Cyp4f14 PE=1 SV=1 CANONICAL=Q9EP75-1" }, "isoforms": [ { "isoform_ac": "A0A3Q4EC89-1", "url": "", "sequence": { "sequence": "MSQLSLSWLGLGPEVAFPWKTLLLLGASWILARILIQIYAAYRNYRHLHGFPQPPKRNWLMGHVGMVTPTEQGLKELTRLVGTYPQGFLMWIGPMVPVITLCHSDIVRSILNASAAVALKDVIFYSILKPWLGDGLLVSAGDKWSRHRRMLTPAFHFNI", "length": 159, "header": "tr|A0A3Q4EC89-1|A0A3Q4EC89_MOUSE Computationally mapped isoform of Cytochrome P450, family 4, subfamily f, polypeptide 14 OS=Mus musculus OX=10090 GN=Cyp4f14 PE=1 SV=1 CANONICAL=Q9EP75-1" }, "locus": { "chromosome": "17", "start_pos": 33135859, "end_pos": 33130461, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000234797.2", "url": "https://www.ensembl.org/id/ENSMUST00000234797.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000157346.2", "url": "https://www.ensembl.org/id/ENSMUSP00000157346.2" } ] } }, { "isoform_ac": "A0A3Q4EHX3-1", "url": "", "sequence": { "sequence": "MSQLSLSWLGLGPEVAFPWKTLLLLGASWILARILIQIYAAYRNYRHLHGFPQPPKRNWLMGHVGMVTPTEQGLKELTRLVGTYPQGFLMWIGPMVPVITLCHSDIVRSILNASAAVALKDVIFYSILKPWLGDGLLVSAGDKWSRHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWQRLISDGSARLDMFEHVSLMTLDSLQKCVFSFDSNCQEKSSEYIAAILELSALVAKRHQQPLMFM", "length": 243, "header": "tr|A0A3Q4EHX3-1|A0A3Q4EHX3_MOUSE Computationally mapped isoform of Cytochrome P450, family 4, subfamily f, polypeptide 14 OS=Mus musculus OX=10090 GN=Cyp4f14 PE=1 SV=1 CANONICAL=Q9EP75-1" }, "locus": { "chromosome": "17", "start_pos": 33135859, "end_pos": 33128285, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000234538.2", "url": "https://www.ensembl.org/id/ENSMUST00000234538.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000157156.2", "url": "https://www.ensembl.org/id/ENSMUSP00000157156.2" } ] } }, { "isoform_ac": "Q9EP75-1", "url": "", "sequence": { "sequence": "MSQLSLSWLGLGPEVAFPWKTLLLLGASWILARILIQIYAAYRNYRHLHGFPQPPKRNWLMGHVGMVTPTEQGLKELTRLVGTYPQGFLMWIGPMVPVITLCHSDIVRSILNASAAVALKDVIFYSILKPWLGDGLLVSAGDKWSRHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWQRLISDGSARLDMFEHVSLMTLDSLQKCVFSFDSNCQEKSSEYIAAILELSALVAKRHQQPLMFMDLLYNLTPDGMRFRKACNVVHEFTDAVIRERHRTLPDQGLDDFLKSKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLARHPEYQERCRQEVQELLRGREPEEIEWDDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGRTIPKGIICLISIFGIHHNPSVWPDPEVYDPFRFDPENIKDSSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRLLPDDKEPRRQPELILRAEGGLWLRVEPLSAGAH", "length": 524, "header": "sp|Q9EP75-1|CP4FE_MOUSE Isoform 1 of Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus OX=10090 GN=Cyp4f14 PE=1 SV=1 CANONICAL=Q9EP75-1" }, "locus": { "chromosome": "17", "start_pos": 33135859, "end_pos": 33124478, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000235058", "url": "https://www.ensembl.org/id/ENSMUST00000235058" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000157006", "url": "https://www.ensembl.org/id/ENSMUSP00000157006" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Cytochrome P4504f, a potential therapeutic target limiting neuroinflammation.", "journal": "Biochemical pharmacology", "date": "2011", "authors": "Sehgal N, Agarwal V, Valli RK, Joshi SD, Antonovic L, Strobel HW, Ravindranath V", "evidence": [ { "database": "RefSeq", "id": "NP_001191262", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262" } ], "reference": [ { "type": "PubMed", "id": "21466787", "url": "https://glygen.org/publication/PubMed/21466787" } ] }, { "title": "Role of omega-hydroxylase in adenosine-mediated aortic response through MAP kinase using A2A-receptor knockout mice.", "journal": "American journal of physiology. Regulatory, integrative and comparative physiology", "date": "2012", "authors": "Ponnoth DS, Nayeem MA, Kunduri SS, Tilley SL, Zeldin DC, Ledent C, Mustafa SJ", "evidence": [ { "database": "RefSeq", "id": "NP_001191262", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262" } ], "reference": [ { "type": "PubMed", "id": "22160543", "url": "https://glygen.org/publication/PubMed/22160543" } ] }, { "title": "Disruption of mouse cytochrome p450 4f14 (Cyp4f14 gene) causes severe perturbations in vitamin E metabolism.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Bardowell SA, Duan F, Manor D, Swanson JE, Parker RS", "evidence": [ { "database": "RefSeq", "id": "NP_001191262", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262" } ], "reference": [ { "type": "PubMed", "id": "22665481", "url": "https://glygen.org/publication/PubMed/22665481" } ] }, { "title": "Disruption of P450-mediated vitamin E hydroxylase activities alters vitamin E status in tocopherol supplemented mice and reveals extra-hepatic vitamin E metabolism.", "journal": "Journal of lipid research", "date": "2012", "authors": "Bardowell SA, Ding X, Parker RS", "evidence": [ { "database": "RefSeq", "id": "NP_001191262", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191262" } ], "reference": [ { "type": "PubMed", "id": "22969154", "url": "https://glygen.org/publication/PubMed/22969154" } ] } ], "pathway": [ { "id": "mmu:64385", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:64385", "resource": "KEGG Pathway" }, { "id": "R-MMU-211979", "name": "Eicosanoids", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-211979", "resource": "Reactome", "description": "Eicosanoids" }, { "id": "R-MMU-2142691", "name": "Synthesis of Leukotrienes (LT) and Eoxins (EX)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2142691", "resource": "Reactome", "description": "Synthesis of Leukotrienes (LT) and Eoxins (EX)" } ], "orthologs": [ { "uniprot_canonical_ac": "P33274-1", "protein_name": "Cytochrome P450 4F1", "gene_name": "Cyp4f1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSQLSLSWLGLGPEVAFPWQTLLLFGASWILAQILTQIYAAYRNFRRLRGFPQPPKRNWLMGHVGMVTPTEQGLKELTRLVGTYPQGFLMWIGPMVPVITLCHSDIVRSILNASAAVALKDVIFYTILKPWLGDGLLVSAGDKWSRHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWKRLISEGSSRLDMFEHVSLMTLDSLQKCVFSFDSNCQEKSSEYIAAILELSALVAKRHQQPLLFMDLLYNLTPDGMRFHKACNLVHEFTDAVIRERRRTLPDQGLDEFLKSKAKSKTLDFIDVLLLTKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWILYNLANDPEYQERCRQEVQELLRDRDPEEIEWDDLAQLPFLTMCIKESLRLHPPVTVISRCCTQDILLPDGRTIPKGIICLISIFGIHHNPSVWPDPEVYNPFRFDPENIKDSSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRLLPDDKEPRRQPELILRAEGGLWLRVEPLTAGAQ", "length": 524 }, "evidence": [ { "id": "45234381", "url": "http://www.informatics.jax.org/homology/45234381", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSQLSLSWLGLWPVAASPWLLLLLVGASWLLAHVLAWTYAFYDNCRRLRCFPQPPRRNWFWGHQGMVNPTEEGMRVLTQLVATYPQGFKVWMGPISPLLSLCHPDIIRSVINASAAIAPKDKFFYSFLEPWLGDGLLLSAGDKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSACLDMFEHISLMTLDSLQKCVFSFDSHCQEKPSEYIAAILELSALVSKRHHEILLHIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWDDLAHLPFLTMCMKESLRLHPPVPVISRHVTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPENIKERSPLAFIPFSAGPRNCIGQTFAMAEMKVVLALTLLRFRVLPDHTEPRRKPELVLRAEGGLWLRVEPLS", "length": 520 }, "evidence": [ { "id": "45234381", "url": "http://www.informatics.jax.org/homology/45234381", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSLLSLSWLGLRPVAASPWLLLLVVGASWLLARILAWTYAFYHNGRRLRCFPQPRKQNWFLGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTLTSQGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREPRRTPEIVLRAEDGLWLRVEPLG", "length": 520 }, "evidence": [ { "id": "45234381", "url": "http://www.informatics.jax.org/homology/45234381", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWFWGHQGLVTPTEEGMKTLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIFNKSVNIMHDKWQRLASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFIDVLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDREPIEIEWDDLAQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVCLINIIGIHYNPTVWPDPEVYDPFRFDQENIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ", "length": 524 }, "evidence": [ { "id": "45234381", "url": "http://www.informatics.jax.org/homology/45234381", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWFWGHLGLITPTEEGLKNSTQMSATYSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAPKDNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQHLASEGSSRLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHILQHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDVLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITCLIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ", "length": 524 }, "evidence": [ { "id": "45234381", "url": "http://www.informatics.jax.org/homology/45234381", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "icosanoid metabolic process", "id": "GO:0006690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006690", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "omega-hydroxylase P450 pathway", "id": "GO:0097267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097267", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "arachidonic acid metabolic process", "id": "GO:0019369", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019369", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "leukotriene B4 catabolic process", "id": "GO:0036101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036101", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 15, "go_terms": [ { "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen", "id": "GO:0016709", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016709", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "fatty acid binding", "id": "GO:0005504", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005504", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "heme binding", "id": "GO:0020037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020037", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "arachidonic acid binding", "id": "GO:0050544", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050544", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "arachidonic acid epoxygenase activity", "id": "GO:0008392", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008392", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "leukotriene-B4 20-monooxygenase activity", "id": "GO:0050051", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050051", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "arachidonic acid omega-hydroxylase activity", "id": "GO:0052869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052869", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "alpha-tocopherol omega-hydroxylase activity", "id": "GO:0052871", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052871", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "tocotrienol omega-hydroxylase activity", "id": "GO:0052872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052872", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "alkane 1-monooxygenase activity", "id": "GO:0018685", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018685", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "arachidonic acid monooxygenase activity", "id": "GO:0008391", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008391", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "long-chain fatty acid omega-hydroxylase activity", "id": "GO:0102033", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0102033", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "monooxygenase activity", "id": "GO:0004497", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004497", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen", "id": "GO:0016705", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016705", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9EP75", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 112, "end_pos": 114, "annotation": "n_glycosylation_sequon" }, { "start_pos": 168, "end_pos": 170, "annotation": "n_glycosylation_sequon" }, { "start_pos": 248, "end_pos": 250, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "22176", "name": "", "equation": "leukotriene B4 + O2 + reduced [NADPH--hemoprotein reductase] = 20-hydroxy-leukotriene B4 + H(+) + H2O + oxidized [NADPH--hemoprotein reductase]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P51869-1", "P33274-1", "Q08477-1", "P78329-1", "Q9EP75-1" ], "evidence": [ { "id": "22176", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/22176" } ] }, { "id": "R-MMU-211873", "name": "CYP4F2, 4F3 20-hydroxylate LTB4", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-266056" ], "output_participant_list": [ "R-ALL-2161636" ], "enzyme_list": [ "A2A974-1", "O88833-1", "Q64462-1", "Q9EP75-1" ], "evidence": [ { "id": "R-MMU-211873", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-211873" } ] }, { "id": "R-MMU-211919", "name": "CYP4F8 19-hydroxylates PGH2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "smooth endoplasmic reticulum", "input_participant_list": [], "output_participant_list": [ "R-ALL-215545" ], "enzyme_list": [ "Q9EP75-1" ], "evidence": [ { "id": "R-MMU-211919", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-211919" } ] }, { "id": "R-MMU-2161745", "name": "20oh-LTB4 is oxidised to 20cho-LTB4 by CYP4F2/4F3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-2142740" ], "enzyme_list": [ "A2A974-1", "O88833-1", "Q64462-1", "Q9EP75-1" ], "evidence": [ { "id": "R-MMU-2161745", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2161745" } ] }, { "id": "R-MMU-2161792", "name": "20cho-LTB4 is oxidised to 20cooh-LTB4 by CYP4F2/4F3", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-2161582" ], "enzyme_list": [ "A2A974-1", "O88833-1", "Q64462-1", "Q9EP75-1" ], "evidence": [ { "id": "R-MMU-2161792", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2161792" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-2142740", "participant_name": "20cho-LTB4 [cytosol]", "crossref": [ { "id": "HMDB0012641", "database": "HMDB Metabolite", "url": "" }, { "id": "000033985160", "database": "ZINC", "url": "" }, { "id": "63979", "database": "ChEBI", "url": "" }, { "id": "63979", "database": "ChEBI", "url": "" }, { "id": "HMDB0012641", "database": "HMDB Metabolite", "url": "" }, { "id": "000033985160", "database": "ZINC", "url": "" }, { "id": "63979", "database": "ChEBI", "url": "" }, { "id": "HMDB0012641", "database": "HMDB Metabolite", "url": "" }, { "id": "000033985160", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-215545", "participant_name": "19OH-PGH2 [endoplasmic reticulum lumen]", "crossref": [ { "id": "63912", "database": "ChEBI", "url": "" }, { "id": "000087528739", "database": "ZINC", "url": "" }, { "id": "000087528742", "database": "ZINC", "url": "" }, { "id": "63912", "database": "ChEBI", "url": "" }, { "id": "000087528739", "database": "ZINC", "url": "" }, { "id": "000087528742", "database": "ZINC", "url": "" }, { "id": "63912", "database": "ChEBI", "url": "" }, { "id": "000087528739", "database": "ZINC", "url": "" }, { "id": "000087528742", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-2161582", "participant_name": "20cooh-LTB4 [cytosol]", "crossref": [ { "id": "27562", "database": "ChEBI", "url": "" }, { "id": "HMDB0006059", "database": "HMDB Metabolite", "url": "" }, { "id": "C05950", "database": "COMPOUND", "url": "" }, { "id": "000004632132", "database": "ZINC", "url": "" }, { "id": "27562", "database": "ChEBI", "url": "" }, { "id": "HMDB0006059", "database": "HMDB Metabolite", "url": "" }, { "id": "C05950", "database": "COMPOUND", "url": "" }, { "id": "000004632132", "database": "ZINC", "url": "" }, { "id": "27562", "database": "ChEBI", "url": "" }, { "id": "HMDB0006059", "database": "HMDB Metabolite", "url": "" }, { "id": "C05950", "database": "COMPOUND", "url": "" }, { "id": "000004632132", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-2161636", "participant_name": "20OH-LTB4 [cytosol]", "crossref": [ { "id": "15646", "database": "ChEBI", "url": "" }, { "id": "HMDB0001509", "database": "HMDB Metabolite", "url": "" }, { "id": "000004629872", "database": "ZINC", "url": "" }, { "id": "C04853", "database": "COMPOUND", "url": "" }, { "id": "3399", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "15646", "database": "ChEBI", "url": "" }, { "id": "HMDB0001509", "database": "HMDB Metabolite", "url": "" }, { "id": "000004629872", "database": "ZINC", "url": "" }, { "id": "C04853", "database": "COMPOUND", "url": "" }, { "id": "3399", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "15646", "database": "ChEBI", "url": "" }, { "id": "HMDB0001509", "database": "HMDB Metabolite", "url": "" }, { "id": "000004629872", "database": "ZINC", "url": "" }, { "id": "C04853", "database": "COMPOUND", "url": "" }, { "id": "3399", "database": "Guide to Pharmacology - Ligands", "url": "" } ] }, { "participant_id": "R-ALL-266056", "participant_name": "LTB4 [cytosol]", "crossref": [ { "id": "000004623738", "database": "ZINC", "url": "" }, { "id": "HMDB0001085", "database": "HMDB Metabolite", "url": "" }, { "id": "C02165", "database": "COMPOUND", "url": "" }, { "id": "HMDB0002995", "database": "HMDB Metabolite", "url": "" }, { "id": "2487", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "15647", "database": "ChEBI", "url": "" }, { "id": "C02165", "database": "COMPOUND", "url": "" }, { "id": "15647", "database": "ChEBI", "url": "" }, { "id": "HMDB0001085", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0002995", "database": "HMDB Metabolite", "url": "" }, { "id": "000004623738", "database": "ZINC", "url": "" }, { "id": "2487", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "C02165", "database": "COMPOUND", "url": "" }, { "id": "15647", "database": "ChEBI", "url": "" }, { "id": "HMDB0001085", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0002995", "database": "HMDB Metabolite", "url": "" }, { "id": "000004623738", "database": "ZINC", "url": "" }, { "id": "2487", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001085", "database": "HMDB Metabolite", "url": "" }, { "id": "000004623738", "database": "ZINC", "url": "" }, { "id": "C02165", "database": "COMPOUND", "url": "" }, { "id": "HMDB0002995", "database": "HMDB Metabolite", "url": "" }, { "id": "2487", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "15647", "database": "ChEBI", "url": "" }, { "id": "HMDB0001085", "database": "HMDB Metabolite", "url": "" }, { "id": "000004623738", "database": "ZINC", "url": "" }, { "id": "C02165", "database": "COMPOUND", "url": "" }, { "id": "2487", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0002995", "database": "HMDB Metabolite", "url": "" }, { "id": "15647", "database": "ChEBI", "url": "" }, { "id": "C02165", "database": "COMPOUND", "url": "" }, { "id": "15647", "database": "ChEBI", "url": "" }, { "id": "HMDB0001085", "database": "HMDB Metabolite", "url": "" }, { "id": "HMDB0002995", "database": "HMDB Metabolite", "url": "" }, { "id": "000004623738", "database": "ZINC", "url": "" }, { "id": "2487", "database": "Guide to Pharmacology - Ligands", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A2A974", "gene_name": "Cyp4a12b", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "A2A974", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A974" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "A2A974", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2A974" } ] } ] }, { "uniprot_ac": "O88833", "gene_name": "Cyp4a10", "activity": [ { "ec_number": "1.14.14.80", "activity": "O2 + octadecanoate + reduced [NADPH--hemoprotein reductase] = 18-hydroxyoctadecanoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "O88833", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88833" } ] } ] }, { "uniprot_ac": "P33274", "gene_name": "Cyp4f1", "activity": [ { "ec_number": "1.14.14.94", "activity": "leukotriene B4 + O2 + reduced [NADPH--hemoprotein reductase] = 20-hydroxy-leukotriene B4 + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P33274", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33274" } ] } ] }, { "uniprot_ac": "P51869", "gene_name": "Cyp4f4", "activity": [ { "ec_number": "1.14.14.94", "activity": "leukotriene B4 + O2 + reduced [NADPH--hemoprotein reductase] = 20-hydroxy-leukotriene B4 + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P51869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51869" } ] } ] }, { "uniprot_ac": "P78329", "gene_name": "CYP4F2", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.78", "activity": "O2 + phylloquinone + reduced [NADPH--hemoprotein reductase] = H(+) + H2O + omega-hydroxyphylloquinone + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.79", "activity": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = 22-hydroxy-(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.94", "activity": "leukotriene B4 + O2 + reduced [NADPH--hemoprotein reductase] = 20-hydroxy-leukotriene B4 + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "P78329", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78329" } ] } ] }, { "uniprot_ac": "Q08477", "gene_name": "CYP4F3", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] }, { "ec_number": "1.14.14.79", "activity": "(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + O2 + reduced [NADPH--hemoprotein reductase] = 22-hydroxy-(4Z,7Z,10Z,13Z,16Z,19Z)-docosahexaenoate + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] }, { "ec_number": "1.14.14.94", "activity": "leukotriene B4 + O2 + reduced [NADPH--hemoprotein reductase] = 20-hydroxy-leukotriene B4 + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q08477", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08477" } ] } ] }, { "uniprot_ac": "Q64462", "gene_name": "Cyp4b1", "activity": [ { "ec_number": "1.14.14.1", "activity": "an organic molecule + O2 + reduced [NADPH--hemoprotein reductase] = an alcohol + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q64462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64462" } ] }, { "ec_number": "1.14.14.1", "activity": "", "evidence": [ { "id": "Q64462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64462" } ] } ] }, { "uniprot_ac": "Q9EP75", "gene_name": "Cyp4f14", "activity": [ { "ec_number": "1.14.14.94", "activity": "leukotriene B4 + O2 + reduced [NADPH--hemoprotein reductase] = 20-hydroxy-leukotriene B4 + H(+) + H2O + oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "Q9EP75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ] }, { "ec_number": "1.14.14.94", "activity": "", "evidence": [ { "id": "Q9EP75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9EP75" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }