{ "uniprot_canonical_ac": "Q9DAN1-1", "uniprot_ac": "Q9DAN1", "uniprot_id": "PDILT_MOUSE", "mass": { "chemical_mass": 67759.0, "monoisotopic_mass": 67759.0 }, "refseq": { "ac": "NP_082219", "name": "protein disulfide-isomerase-like protein of the testis precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082219" }, "gene_names": [ { "name": "Pdilt", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9DAN1", "id": "Q9DAN1" }, { "name": "1700007B13Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082219", "id": "NP_082219" }, { "name": "Pdilt", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082219", "id": "NP_082219" } ], "protein_names": [ { "name": "Protein disulfide-isomerase-like protein of the testis", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9DAN1" }, { "name": "protein disulfide-isomerase-like protein of the testis precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082219", "id": "NP_082219" }, { "name": "protein disulfide-isomerase-like protein of the testis", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082219", "id": "NP_082219" } ], "function": [ { "annotation": "Probable redox-inactive chaperone involved in spermatogenesis.", "evidence": [ { "database": "UniProtKB", "id": "Q9DAN1", "url": "https://www.uniprot.org/uniprot/Q9DAN1#function" } ] }, { "annotation": "Protein disulfide isomerase homolog PDILT is required for quality control of sperm membrane protein ADAM3 and male infertility Erratum:[Proc Natl Acad Sci U S A. 2012 Apr 10;109(15):5905]", "evidence": [ { "database": "RefSeq", "id": "NP_082219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082219" }, { "database": "PubMed", "id": "22357757", "url": "https://glygen.org/publication/PubMed/22357757" } ] }, { "annotation": "The expression of PDILT, in addition to PDI in the testis, suggests that PDILT performs a specialized chaperone function in testicular cells. [PDILT]", "evidence": [ { "database": "RefSeq", "id": "NP_082219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082219" }, { "database": "PubMed", "id": "15475357", "url": "https://glygen.org/publication/PubMed/15475357" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3388945110", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388945110" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 102, "end_pos": 102, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KET->NET).", "chr_id": "7", "chr_pos": "119114191", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K102", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9DAN1", "url": "https://www.uniprot.org/uniprot/Q9DAN1" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Pdilt", "url": "https://www.uniprot.org/uniprot/Q9DAN1", "locus": { "chromosome": "7", "start_pos": 119085810, "end_pos": 119122712, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000030968", "url": "https://www.ensembl.org/id/ENSMUSG00000030968" } ] } } ], "crossref": [ { "id": "ENSMUSG00000030968", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000030968", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd02961", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02961", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd02981", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02981", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd02982", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02982", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd02995", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02995", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "71830", "url": "https://www.ncbi.nlm.nih.gov/gene/71830", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0007438", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0007438", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "Q9DAN1", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9DAN1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013766", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013766", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:71830", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:71830", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1919080", "url": "http://www.informatics.jax.org/marker/MGI:1919080", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "APWSKKC", "url": "https://omabrowser.org/oma/group/APWSKKC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5399045at2759", "url": "http://www.orthodb.org/?query=5399045at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR18929", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18929", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR18929:SF58", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18929:SF58", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00085", "url": "http://pfam.xfam.org/family/PF00085", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13848", "url": "http://pfam.xfam.org/family/PF13848", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9DAN1", "url": "http://purl.obolibrary.org/obo/PR_Q9DAN1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_082219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082219", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A140LI41", "url": "https://www.uniprot.org/uniprot/A0A140LI41", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LI41-1", "url": "https://www.uniprot.org/uniprot/A0A140LI41-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9DAN1", "url": "https://www.uniprot.org/uniprot/Q9DAN1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9DAN1-1", "url": "https://www.uniprot.org/uniprot/Q9DAN1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MELLWTPLLLVAACLSEVLGSPEIDTGINISQPLHILEDHNLMVLTPAGLTQTLNETRFLMVIFHNPSLKQSRKLAKELGKAAEIFGKGKNGLGFGKVDITKETELQQEFDITHAPELKLFFEGNRLKPISCKDVVESTALVVWLRRQISKKALLFNNSDEVADFVKSRPLVIVGFFQDLEEEVAELFYDTIKDFPELTFGAIQIKNSFGRFHVILDSVLVFKKGKIVKRQELINDSTNKDHLNQVIKQQLTGFVIELNPENKDLIYELNILNHMLLFISKSSEPYSTISRHYRQIAKEFQNKILFVLVNADEPKNKRIFEYFQISRVNVPSVQILNLSSDGRYKMPTDDINFESLKKFCNSFLSKTAKKHKASEEIPKYWDQGPVKKLVGKNFNVVVLDKEKDVFVMFYAPWSEKCRVLLPLLEELGIKYQNHSTVIIAKIDITANDIQLANPEQYPFFRLFPTDSQEAVMYKGEHTMKGFCDFLESHVKVRIEEEDELLYIEQNEEEEVLAEPEIQLIEKLPENPLLKIEDTSKQDRPVKESPVLDSIRKPEEPERRKETAEREAAAAQPKEQPKPERKLEVKEEL", "length": 588, "header": "sp|Q9DAN1-1|PDILT_MOUSE Isoform 1 of Protein disulfide-isomerase-like protein of the testis OS=Mus musculus OX=10090 GN=Pdilt PE=1 SV=2 CANONICAL=Q9DAN1-1" }, "isoforms": [ { "isoform_ac": "A0A140LI41-1", "url": "", "sequence": { "sequence": "LLIRKESRGVRNSESHQNTIKGKIVKRQELINDSTNKDHLNQVIKQQLTGFVIELNPENKDLIYELNILNHMLLFISKSSEPYSTISRHYRQIAKEFQNKFP", "length": 102, "header": "tr|A0A140LI41-1|PDILT_MOUSE Computationally mapped isoform of Protein disulfide-isomerase-like protein of the testis OS=Mus musculus OX=10090 GN=Pdilt PE=1 SV=1 CANONICAL=Q9DAN1-1" }, "locus": { "chromosome": "7", "start_pos": 119098008, "end_pos": 119095826, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000208275.2", "url": "https://www.ensembl.org/id/ENSMUST00000208275.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000146664.2", "url": "https://www.ensembl.org/id/ENSMUSP00000146664.2" } ] } }, { "isoform_ac": "Q9DAN1-1", "url": "", "sequence": { "sequence": "MELLWTPLLLVAACLSEVLGSPEIDTGINISQPLHILEDHNLMVLTPAGLTQTLNETRFLMVIFHNPSLKQSRKLAKELGKAAEIFGKGKNGLGFGKVDITKETELQQEFDITHAPELKLFFEGNRLKPISCKDVVESTALVVWLRRQISKKALLFNNSDEVADFVKSRPLVIVGFFQDLEEEVAELFYDTIKDFPELTFGAIQIKNSFGRFHVILDSVLVFKKGKIVKRQELINDSTNKDHLNQVIKQQLTGFVIELNPENKDLIYELNILNHMLLFISKSSEPYSTISRHYRQIAKEFQNKILFVLVNADEPKNKRIFEYFQISRVNVPSVQILNLSSDGRYKMPTDDINFESLKKFCNSFLSKTAKKHKASEEIPKYWDQGPVKKLVGKNFNVVVLDKEKDVFVMFYAPWSEKCRVLLPLLEELGIKYQNHSTVIIAKIDITANDIQLANPEQYPFFRLFPTDSQEAVMYKGEHTMKGFCDFLESHVKVRIEEEDELLYIEQNEEEEVLAEPEIQLIEKLPENPLLKIEDTSKQDRPVKESPVLDSIRKPEEPERRKETAEREAAAAQPKEQPKPERKLEVKEEL", "length": 588, "header": "sp|Q9DAN1-1|PDILT_MOUSE Isoform 1 of Protein disulfide-isomerase-like protein of the testis OS=Mus musculus OX=10090 GN=Pdilt PE=1 SV=2 CANONICAL=Q9DAN1-1" }, "locus": { "chromosome": "7", "start_pos": 119119047, "end_pos": 119085950, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000033267", "url": "https://www.ensembl.org/id/ENSMUST00000033267" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000033267", "url": "https://www.ensembl.org/id/ENSMUSP00000033267" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 157, "start_aa": "Asn", "end_pos": 157, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn157", "evidence": [ { "id": "Q9DAN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DAN1#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 337, "start_aa": "Asn", "end_pos": 337, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn337", "evidence": [ { "id": "Q9DAN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DAN1#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 55, "start_aa": "Asn", "end_pos": 55, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn55", "evidence": [ { "id": "Q9DAN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DAN1#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "PDILT, a divergent testis-specific protein disulfide isomerase with a non-classical SXXC motif that engages in disulfide-dependent interactions in the endoplasmic reticulum.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "van Lith M, Hartigan N, Hatch J, Benham AM", "evidence": [ { "database": "UniProtKB", "id": "Q9DAN1", "url": "https://www.uniprot.org/uniprot/Q9DAN1" }, { "database": "RefSeq", "id": "NP_082219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082219" } ], "reference": [ { "type": "PubMed", "id": "15475357", "url": "https://glygen.org/publication/PubMed/15475357" } ] }, { "title": "A developmentally regulated chaperone complex for the endoplasmic reticulum of male haploid germ cells.", "journal": "Mol. Biol. Cell", "date": "2007", "authors": "van Lith M, Karala AR, Bown D, Gatehouse JA, Ruddock LW, Saunders PT, Benham AM", "evidence": [ { "database": "UniProtKB", "id": "Q9DAN1", "url": "https://www.uniprot.org/uniprot/Q9DAN1" } ], "reference": [ { "type": "PubMed", "id": "17507649", "url": "https://glygen.org/publication/PubMed/17507649" } ] }, { "title": "Protein disulfide isomerase homolog PDILT is required for quality control of sperm membrane protein ADAM3 and male fertility [corrected].", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Tokuhiro K, Ikawa M, Benham AM, Okabe M", "evidence": [ { "database": "RefSeq", "id": "NP_082219", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082219" } ], "reference": [ { "type": "PubMed", "id": "22357757", "url": "https://glygen.org/publication/PubMed/22357757" } ] } ], "pathway": [ { "id": "mmu:71830", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:71830", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q5XI02-1", "protein_name": "Protein disulfide-isomerase-like protein of the testis", "gene_name": "Pdilt", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MELLWTPLLLLAACLSEVLGSPEMDTGINISQPLHILEDHNLMVLTPAGLTQTLNETRFLMVIFHNPTLKQSRKLAKELGKAAEIFGKGKNGLGFGKVDITMETELKQEFDITHAPELKLFYEGNRLEPISCKDVVESTALVVWLRRQISKKALLFNNSNEVADFVKSRPLVIVGFFQDLEEEVAELFYDTIKDFPELTFGAIQIKNSFGRFHVILDSVLVFKKGRVVKRQELINDSTNKDYLNQVIKQQLTGFVIEFNPENKDLIYEMNILNHMLLFISKNSEPYSTIIRHYRQISKEFQNKILFVLVNSDEPKNKRIFEYFQISRVNVPSVQILNLSSDARYKMPTDNITFESLKKFCNSFLSRTAKKHKSSEEIPKYWDQEPVKKLVGKNFNVVVFDKEKDVFVMFYAPWSEKCRVLLPLLEELGIKYQNHSTVIIAKIDITANDIQLANPEQYPFFRLFPTDSQEAVMYKGEHTMKGFCDFLESHVKVRIEEDDELLYIEQNEVAEEEVLAEPEMQHIDKLPEKPPLKVEDTSKQDRPAKESPALGSISQPEELERRKETAEKEKKVAQPKEQPKPERKLDIKEEL", "length": 590 }, "evidence": [ { "id": "45228274", "url": "http://www.informatics.jax.org/homology/45228274", "database": "MGI" }, { "id": "Q9DAN1", "url": "https://omabrowser.org/oma/group/Q9DAN1/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8N807-1", "protein_name": "Protein disulfide-isomerase-like protein of the testis", "gene_name": "PDILT", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDLLWMPLLLVAACVSAVHSSPEVNAGVSSIHITKPVHILEERSLLVLTPAGLTQMLNQTRFLMVLFHNPSSKQSRNLAEELGKAVEIMGKGKNGIGFGKVDITIEKELQQEFGITKAPELKLFFEGNRSEPISCKGVVESAALVVWLRRQISQKAFLFNSSEQVAEFVISRPLVIVGFFQDLEEEVAELFYDVIKDFPELTFGVITIGNVIGRFHVTLDSVLVFKKGKIVNRQKLINDSTNKQELNRVIKQHLTDFVIEYNTENKDLISELHIMSHMLLFVSKSSESYGIIIQHYKLASKEFQNKILFILVDADEPRNGRVFKYFRVTEVDIPSVQILNLSSDARYKMPSDDITYESLKKFGRSFLSKNATKHQSSEEIPKYWDQGLVKQLVGKNFNVVVFDKEKDVFVMFYAPWSKKCKMLFPLLEELGRKYQNHSTIIIAKIDVTANDIQLMYLDRYPFFRLFPSGSQQAVLYKGEHTLKGFSDFLESHIKTKIEDEDELLSVEQNEVIEEEVLAEEKEVPMMRKGLPEQQSPELENMTKYVSKLEEPAGKKKTSEEVVVVVAKPKGPPVQKKKPKVKEEL", "length": 584 }, "evidence": [ { "id": "45228274", "url": "http://www.informatics.jax.org/homology/45228274", "database": "MGI" }, { "id": "Q9DAN1", "url": "https://omabrowser.org/oma/group/Q9DAN1/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "Q9DAN1", "url": "https://www.uniprot.org/uniprot/Q9DAN1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "spermatid development", "id": "GO:0007286", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007286", "evidence": [ { "database": "UniProtKB", "id": "Q9DAN1", "url": "https://www.uniprot.org/uniprot/Q9DAN1" } ], "pmid": "" }, { "name": "protein folding", "id": "GO:0006457", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006457", "evidence": [ { "database": "UniProtKB", "id": "Q9DAN1", "url": "https://www.uniprot.org/uniprot/Q9DAN1" } ], "pmid": "" }, { "name": "germ cell migration", "id": "GO:0008354", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008354", "evidence": [ { "database": "UniProtKB", "id": "Q9DAN1", "url": "https://www.uniprot.org/uniprot/Q9DAN1" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "protein disulfide isomerase activity", "id": "GO:0003756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003756", "evidence": [ { "database": "UniProtKB", "id": "Q9DAN1", "url": "https://www.uniprot.org/uniprot/Q9DAN1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 157, "end_pos": 159, "annotation": "n_glycosylation_sequon" }, { "start_pos": 235, "end_pos": 237, "annotation": "n_glycosylation_sequon" }, { "start_pos": 29, "end_pos": 31, "annotation": "n_glycosylation_sequon" }, { "start_pos": 337, "end_pos": 339, "annotation": "n_glycosylation_sequon" }, { "start_pos": 433, "end_pos": 435, "annotation": "n_glycosylation_sequon" }, { "start_pos": 55, "end_pos": 57, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }