{ "uniprot_canonical_ac": "Q9D975-1", "uniprot_ac": "Q9D975", "uniprot_id": "SRXN1_MOUSE", "mass": { "chemical_mass": 14149.0, "monoisotopic_mass": 14149.0 }, "refseq": { "ac": "NP_083964", "name": "sulfiredoxin-1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083964" }, "gene_names": [ { "name": "Srxn1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9D975", "id": "Q9D975" }, { "name": "1700127B04Rik; Npn3; Srx; Srx1; TX01", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083964", "id": "NP_083964" }, { "name": "Npn3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9D975", "id": "Q9D975" }, { "name": "Srxn1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083964", "id": "NP_083964" }, { "name": "Srx", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9D975", "id": "Q9D975" } ], "protein_names": [ { "name": "Sulfiredoxin-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9D975" }, { "name": "1.8.98.2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D975" }, { "name": "Neoplastic progression protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D975" }, { "name": "neoplastic progression 3; neoplastic progression protein 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083964", "id": "NP_083964" }, { "name": "sulfiredoxin-1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083964", "id": "NP_083964" } ], "function": [ { "annotation": "Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in the peroxiredoxins PRDX1, PRDX2, PRDX3 and PRDX4. Does not act on PRDX5 or PRDX6. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase.", "evidence": [ { "database": "UniProtKB", "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975#function" }, { "database": "PubMed", "id": "15448164", "url": "https://glygen.org/publication/PubMed/15448164" } ] }, { "annotation": "Essential for normal responses to GnRH stimulation and plays an important role in reactive oxygen species management", "evidence": [ { "database": "RefSeq", "id": "NP_083964", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083964" }, { "database": "PubMed", "id": "31504396", "url": "https://glygen.org/publication/PubMed/31504396" } ] }, { "annotation": "These results demonstrated that Srxn1 protects podocytes from high glucose-induced injury by promoting the activation of Nrf2/ARE signaling associated with inactivating GSK-3beta, indicating a potential role of Srxn1 in diabetic nephropathy.", "evidence": [ { "database": "RefSeq", "id": "NP_083964", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083964" }, { "database": "PubMed", "id": "31284950", "url": "https://glygen.org/publication/PubMed/31284950" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Srxn1", "url": "https://www.uniprot.org/uniprot/Q9D975", "locus": { "chromosome": "2", "start_pos": 151953296, "end_pos": 151947436, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000032802", "url": "https://www.ensembl.org/id/ENSMUSG00000032802" } ] } } ], "crossref": [ { "id": "ENSMUSG00000032802", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000032802", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.8.98.2", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.8.98.2&UniProtAcc=Q9D975", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd16395", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16395", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "76650", "url": "https://www.ncbi.nlm.nih.gov/gene/76650", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003115", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003115", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016692", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016692", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036086", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036086", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:76650", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:76650", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "104971", "url": "http://www.informatics.jax.org/marker/MGI:104971", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "IRPFPPV", "url": "https://omabrowser.org/oma/group/IRPFPPV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5482730at2759", "url": "http://www.orthodb.org/?query=5482730at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21348", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21348", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21348:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21348:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02195", "url": "http://pfam.xfam.org/family/PF02195", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9D975", "url": "http://purl.obolibrary.org/obo/PR_Q9D975", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-9818027", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9818027", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_083964", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083964", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "17545", "url": "https://www.rhea-db.org/rhea/17545", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A2AQU8", "url": "https://www.uniprot.org/uniprot/A2AQU8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2AQU8-1", "url": "https://www.uniprot.org/uniprot/A2AQU8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D975-1", "url": "https://www.uniprot.org/uniprot/Q9D975-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGLRAGGALRRAGAGPGAPEGQGPGGAQGGSIHSGCIATVHNVPIAVLIRPLPSVLDPAKVQSLVDTILADPDSVPPIDVLWIKGAQGGDYYYSFGGCHRYAAYQQLQRETIPAKLVRSTLSDLRMYLGASTPDLQ", "length": 136, "header": "sp|Q9D975-1|SRXN1_MOUSE Isoform 1 of Sulfiredoxin-1 OS=Mus musculus OX=10090 GN=Srxn1 PE=2 SV=1 CANONICAL=Q9D975-1" }, "isoforms": [ { "isoform_ac": "A2AQU8-1", "url": "", "sequence": { "sequence": "MVQPGLVKRPGGTGHQGRGMGLRAGGALRRAGAGPGAPEGQGPGGAQGGSIHSGCIATVHNVPIAVLIRPLPSVLDPAKVQSLVDTILADPDSVPPIDVLWIKGAQGGDYYYSFGGCHRYAAYQQLQRETIPAKLVRSTLSDLRMYLGASTPDLQ", "length": 155, "header": "tr|A2AQU8-1|SRXN1_MOUSE Computationally mapped isoform of Sulfiredoxin-1 OS=Mus musculus OX=10090 GN=Srxn1 PE=2 SV=1 CANONICAL=Q9D975-1" }, "locus": { "chromosome": "2", "start_pos": 151951109, "end_pos": 151947604, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000041500.8", "url": "https://www.ensembl.org/id/ENSMUST00000041500.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000046196.8", "url": "https://www.ensembl.org/id/ENSMUSP00000046196.8" } ] } }, { "isoform_ac": "Q9D975-1", "url": "", "sequence": { "sequence": "MGLRAGGALRRAGAGPGAPEGQGPGGAQGGSIHSGCIATVHNVPIAVLIRPLPSVLDPAKVQSLVDTILADPDSVPPIDVLWIKGAQGGDYYYSFGGCHRYAAYQQLQRETIPAKLVRSTLSDLRMYLGASTPDLQ", "length": 136, "header": "sp|Q9D975-1|SRXN1_MOUSE Isoform 1 of Sulfiredoxin-1 OS=Mus musculus OX=10090 GN=Srxn1 PE=2 SV=1 CANONICAL=Q9D975-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 31, "end_pos": 31, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975" } ], "site_lbl": "Ser31" } ], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Characterization of mammalian sulfiredoxin and its reactivation of hyperoxidized peroxiredoxin through reduction of cysteine sulfinic acid in the active site to cysteine.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Chang TS, Jeong W, Woo HA, Lee SM, Park S, Rhee SG", "evidence": [ { "database": "UniProtKB", "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975" } ], "reference": [ { "type": "PubMed", "id": "15448164", "url": "https://glygen.org/publication/PubMed/15448164" } ] }, { "title": "Sulfiredoxin-1 alleviates high glucose-induced podocyte injury though promoting Nrf2/ARE signaling via inactivation of GSK-3beta.", "journal": "Biochemical and biophysical research communications", "date": "2019", "authors": "Shen Y, Chen S, Zhao Y", "evidence": [ { "database": "RefSeq", "id": "NP_083964", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083964" } ], "reference": [ { "type": "PubMed", "id": "31284950", "url": "https://glygen.org/publication/PubMed/31284950" } ] }, { "title": "SRXN1 Is Necessary for Resolution of GnRH-Induced Oxidative Stress and Induction of Gonadotropin Gene Expression.", "journal": "Endocrinology", "date": "2019", "authors": "Kim T, Li D, Terasaka T, Nicholas DA, Knight VS, Yang JJ, Lawson MA", "evidence": [ { "database": "RefSeq", "id": "NP_083964", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083964" } ], "reference": [ { "type": "PubMed", "id": "31504396", "url": "https://glygen.org/publication/PubMed/31504396" } ] } ], "pathway": [ { "id": "mmu:76650", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:76650", "resource": "KEGG Pathway" }, { "id": "R-MMU-9818027", "name": "NFE2L2 regulating anti-oxidant/detoxification enzymes", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9818027", "resource": "Reactome", "description": "NFE2L2 regulating anti-oxidant/detoxification enzymes" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9BYN0-1", "protein_name": "Sulfiredoxin-1", "gene_name": "SRXN1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ", "length": 137 }, "evidence": [ { "id": "45230233", "url": "http://www.informatics.jax.org/homology/45230233", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975" } ], "pmid": "" }, { "name": "sulfiredoxin activity", "id": "GO:0032542", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032542", "evidence": [ { "database": "UniProtKB", "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on a sulfur group of donors", "id": "GO:0016667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016667", "evidence": [ { "database": "UniProtKB", "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "response to oxidative stress", "id": "GO:0006979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979", "evidence": [ { "database": "UniProtKB", "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975" } ], "pmid": "" }, { "name": "cellular response to oxidative stress", "id": "GO:0034599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034599", "evidence": [ { "database": "UniProtKB", "id": "Q9D975", "url": "https://www.uniprot.org/uniprot/Q9D975" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "17545", "name": "", "equation": "[protein]-dithiol + ATP + S-hydroxy-S-oxy-L-cysteinyl-[peroxiredoxin] = [protein]-disulfide + ADP + phosphate + S-hydroxy-L-cysteinyl-[peroxiredoxin]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q7TP44-1", "Q9BYN0-1", "Q9D975-1", "P36077-1", "Q9VX10-1" ], "evidence": [ { "id": "17545", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17545" } ] }, { "id": "R-MMU-9760094", "name": "SRXN1 reduces hyperoxidized PRDX1 dimer", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P35700-1", "Q9D975-1" ], "evidence": [ { "id": "R-MMU-9760094", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9760094" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "P35700", "gene_name": "Prdx1", "activity": [ { "ec_number": "1.11.1.24", "activity": "[thioredoxin]-dithiol + a hydroperoxide = [thioredoxin]-disulfide + an alcohol + H2O.", "evidence": [ { "id": "P35700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35700" } ] }, { "ec_number": "1.11.1.24", "activity": "", "evidence": [ { "id": "P35700", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35700" } ] } ] }, { "uniprot_ac": "P36077", "gene_name": "SRX1", "activity": [ { "ec_number": "1.8.98.2", "activity": "[protein]-dithiol + ATP + S-hydroxy-S-oxy-L-cysteinyl-[peroxiredoxin] = [protein]-disulfide + ADP + phosphate + S-hydroxy-L-cysteinyl-[peroxiredoxin].", "evidence": [ { "id": "P36077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36077" } ] }, { "ec_number": "1.8.98.2", "activity": "", "evidence": [ { "id": "P36077", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36077" } ] } ] }, { "uniprot_ac": "Q7TP44", "gene_name": "Srxn1", "activity": [ { "ec_number": "1.8.98.2", "activity": "[protein]-dithiol + ATP + S-hydroxy-S-oxy-L-cysteinyl-[peroxiredoxin] = [protein]-disulfide + ADP + phosphate + S-hydroxy-L-cysteinyl-[peroxiredoxin].", "evidence": [ { "id": "Q7TP44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TP44" } ] }, { "ec_number": "1.8.98.2", "activity": "", "evidence": [ { "id": "Q7TP44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TP44" } ] } ] }, { "uniprot_ac": "Q9BYN0", "gene_name": "SRXN1", "activity": [ { "ec_number": "1.8.98.2", "activity": "[protein]-dithiol + ATP + S-hydroxy-S-oxy-L-cysteinyl-[peroxiredoxin] = [protein]-disulfide + ADP + phosphate + S-hydroxy-L-cysteinyl-[peroxiredoxin].", "evidence": [ { "id": "Q9BYN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYN0" } ] }, { "ec_number": "1.8.98.2", "activity": "", "evidence": [ { "id": "Q9BYN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYN0" } ] } ] }, { "uniprot_ac": "Q9D975", "gene_name": "Srxn1", "activity": [ { "ec_number": "1.8.98.2", "activity": "[protein]-dithiol + ATP + S-hydroxy-S-oxy-L-cysteinyl-[peroxiredoxin] = [protein]-disulfide + ADP + phosphate + S-hydroxy-L-cysteinyl-[peroxiredoxin].", "evidence": [ { "id": "Q9D975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D975" } ] }, { "ec_number": "1.8.98.2", "activity": "", "evidence": [ { "id": "Q9D975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D975" } ] } ] }, { "uniprot_ac": "Q9VX10", "gene_name": "Srx", "activity": [ { "ec_number": "1.8.98.2", "activity": "[protein]-dithiol + ATP + S-hydroxy-S-oxy-L-cysteinyl-[peroxiredoxin] = [protein]-disulfide + ADP + phosphate + S-hydroxy-L-cysteinyl-[peroxiredoxin].", "evidence": [ { "id": "Q9VX10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VX10" } ] }, { "ec_number": "1.8.98.2", "activity": "", "evidence": [ { "id": "Q9VX10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VX10" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }