{ "uniprot_canonical_ac": "Q9D6Z1-1", "uniprot_ac": "Q9D6Z1", "uniprot_id": "NOP56_MOUSE", "mass": { "chemical_mass": 64464.0, "monoisotopic_mass": 64464.0 }, "refseq": { "ac": "NP_077155", "name": "nucleolar protein 56", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077155" }, "gene_names": [ { "name": "Nop56", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9D6Z1", "id": "Q9D6Z1" }, { "name": "2310044F10Rik; Nol5a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077155", "id": "NP_077155" }, { "name": "Nol5a", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9D6Z1", "id": "Q9D6Z1" }, { "name": "Nop56", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077155", "id": "NP_077155" } ], "protein_names": [ { "name": "Nucleolar protein 56", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9D6Z1" }, { "name": "Nucleolar protein 5A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D6Z1" }, { "name": "nucleolar protein 56", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077155", "id": "NP_077155" }, { "name": "nucleolar protein 5A; 56kDa with KKE/D repeat; NOP56 ribonucleoprotein homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077155", "id": "NP_077155" } ], "function": [ { "annotation": "Involved in the early to middle stages of 60S ribosomal subunit biogenesis. Core component of box C/D small nucleolar ribonucleoprotein (snoRNP) particles. Required for the biogenesis of box C/D snoRNAs such U3, U8 and U14 snoRNAs. Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome.", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1#function" }, { "database": "UniProtKB", "id": "O00567", "url": "https://www.uniprot.org/uniprot/O00567#function" } ] }, { "annotation": "The study suggests a progressive loss of nuclear proteins and subsequent RNA processing problems including a novel gene relating to amyotrophic lateral sclerosis (NOP56) under the motor neuron degeneration.", "evidence": [ { "database": "RefSeq", "id": "NP_077155", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077155" }, { "database": "PubMed", "id": "23582672", "url": "https://glygen.org/publication/PubMed/23582672" } ] } ], "disease": [ { "disease_id": "DOID:0050983", "recommended_name": { "id": "DOID:0050983", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050983", "name": "spinocerebellar ataxia type 36", "description": "An autosomal dominant cerebellar ataxia that is characterized by progressive ataxia, dysarthria, hyperreflexia, sensiorineural hearing loss and muscle atrophy, has_material_basis_in mutation in the NOP56 gene." }, "synonyms": [ { "id": "MONDO:0013594", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013594", "name": "spinocerebellar ataxia type 36", "description": "Spinocerebellar ataxia type 36 (SCA36) is a subtype of autosomal dominant cerebellar ataxia type 1 (ADCA type 1) characterized by gait and limb ataxia, lower limb spasticity, dysarthria, muscle fasiculations, tongue atrophy and hyperreflexia." }, { "id": "MONDO:0013594", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013594", "name": "Asidan", "description": "" }, { "id": "MONDO:0013594", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013594", "name": "SCA36", "description": "" }, { "id": "MONDO:0013594", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013594", "name": "spinocerebellar ataxia type 36", "description": "" }, { "id": "MONDO:0013594", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013594", "name": "spinocerebellar ataxia 36", "description": "" }, { "id": "MIM:614153", "resource": "MIM", "url": "https://www.omim.org/entry/614153", "name": "Spinocerebellar ataxia 36", "description": "Spinocerebellar ataxia 36" } ], "evidence": [ { "id": "0050983", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050983" } ] } ], "snv": [ { "evidence": [ { "id": "rs3388584357", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388584357" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 169, "end_pos": 169, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IQS->NQS).", "chr_id": "2", "chr_pos": "130118031", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I169", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Nop56", "url": "https://www.uniprot.org/uniprot/Q9D6Z1", "locus": { "chromosome": "2", "start_pos": 130121233, "end_pos": 130116350, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000027405", "url": "https://www.ensembl.org/id/ENSMUSG00000027405" } ] } } ], "crossref": [ { "id": "ENSMUSG00000027405", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000027405", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL4879510", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4879510", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "67134", "url": "https://www.ncbi.nlm.nih.gov/gene/67134", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0002313", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0002313", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0002712", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0002712", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0007389", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0007389", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "Q9D6Z1", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9D6Z1*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002687", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002687", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012974", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012974", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012976", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012976", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036070", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036070", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042239", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042239", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045056", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045056", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:67134", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67134", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1914384", "url": "http://www.informatics.jax.org/marker/MGI:1914384", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9D6Z1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9D6Z1", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DNYMFAK", "url": "https://omabrowser.org/oma/group/DNYMFAK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5489581at2759", "url": "http://www.orthodb.org/?query=5489581at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10894", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10894", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10894:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10894:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01798", "url": "http://pfam.xfam.org/family/PF01798", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08156", "url": "http://pfam.xfam.org/family/PF08156", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9D6Z1", "url": "http://purl.obolibrary.org/obo/PR_Q9D6Z1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-6791226", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6791226", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_077155", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077155", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A2APD7", "url": "https://www.uniprot.org/uniprot/A2APD7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2APD7-1", "url": "https://www.uniprot.org/uniprot/A2APD7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E0CXZ0", "url": "https://www.uniprot.org/uniprot/E0CXZ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E0CXZ0-1", "url": "https://www.uniprot.org/uniprot/E0CXZ0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6TLG3", "url": "https://www.uniprot.org/uniprot/F6TLG3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6TLG3-1", "url": "https://www.uniprot.org/uniprot/F6TLG3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6U250", "url": "https://www.uniprot.org/uniprot/F6U250", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6U250-1", "url": "https://www.uniprot.org/uniprot/F6U250-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6USW7", "url": "https://www.uniprot.org/uniprot/F6USW7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6USW7-1", "url": "https://www.uniprot.org/uniprot/F6USW7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6V095", "url": "https://www.uniprot.org/uniprot/F6V095", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6V095-1", "url": "https://www.uniprot.org/uniprot/F6V095-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7CHP9", "url": "https://www.uniprot.org/uniprot/F7CHP9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7CHP9-1", "url": "https://www.uniprot.org/uniprot/F7CHP9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7CHQ7", "url": "https://www.uniprot.org/uniprot/F7CHQ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F7CHQ7-1", "url": "https://www.uniprot.org/uniprot/F7CHQ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D6Z1-1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVLLHVLFEHAVGYALLALKEVEEISLLLPQVEECVLNLGKFHNVVRLVAFCPFSSSQVALENANAVSEGVVHEDLRLLLETYLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIVNDNATYCRLAQFIGNRRELNEEKLEKLEEITMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAVVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSTPEECEEVNEKSKKKKKLKPQENGMEDPPVSLPKSKKKKAPKEELASDLEEMATSSAKRKKSSPKEEVASEPEEAASPTTPKKKRKFSEEPEVAANFTKSSTKKKKKSQKAQED", "length": 580, "header": "sp|Q9D6Z1-1|NOP56_MOUSE Isoform 1 of Nucleolar protein 56 OS=Mus musculus OX=10090 GN=Nop56 PE=1 SV=2 CANONICAL=Q9D6Z1-1" }, "isoforms": [ { "isoform_ac": "A2APD7-1", "url": "", "sequence": { "sequence": "VRCCFWCPLFCLGITMMADQGNLTYTGLCYGGDGQSWCLSDSQGPAKGDRVSRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAVVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSTPEECEEVNEKSKKKKKLKPQENGMEDPPVSLPKSKKKKAPKEELASDLEEMATSSAKRKKSSPKEEVASEPEEAASPTTPKKKRKFSEEPEVAANFTKSSTKKKKKSQKAQED", "length": 296, "header": "tr|A2APD7-1|NOP56_MOUSE Computationally mapped isoform of Nucleolar protein 56 OS=Mus musculus OX=10090 GN=Nop56 PE=1 SV=1 CANONICAL=Q9D6Z1-1" }, "locus": { "chromosome": "2", "start_pos": 130121140, "end_pos": 130119077, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000028890.15", "url": "https://www.ensembl.org/id/ENSMUST00000028890.15" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000028890.9", "url": "https://www.ensembl.org/id/ENSMUSP00000028890.9" } ] } }, { "isoform_ac": "E0CXZ0-1", "url": "", "sequence": { "sequence": "MVLLHVLFEHAVGYALLALKEVEEISLLLPQVEECVLNLGKFHNVVRLVAFCPFSSSQVALENANAVSEGVVHEDLRLLLETYLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIVNDNATYCRLAQFIGNRRELNEEKLEKLEEITMDGAKAKAILDASRSSMGQCGARQPV", "length": 261, "header": "tr|E0CXZ0-1|E0CXZ0_MOUSE Computationally mapped isoform of NOP56 ribonucleoprotein OS=Mus musculus OX=10090 GN=Nop56 PE=1 SV=1 CANONICAL=Q9D6Z1-1" }, "locus": { "chromosome": "2", "start_pos": 130118569, "end_pos": 130116394, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000136621.9", "url": "https://www.ensembl.org/id/ENSMUST00000136621.9" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000124616.2", "url": "https://www.ensembl.org/id/ENSMUSP00000124616.2" } ] } }, { "isoform_ac": "F6TLG3-1", "url": "", "sequence": { "sequence": "XLDASRSSMGQCGARQPV", "length": 18, "header": "tr|F6TLG3-1|F6TLG3_MOUSE Computationally mapped isoform of NOP56 ribonucleoprotein OS=Mus musculus OX=10090 GN=Nop56 PE=4 SV=1 CANONICAL=Q9D6Z1-1" }, "locus": { "chromosome": "2", "start_pos": 130118570, "end_pos": 130118517, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000143547.2", "url": "https://www.ensembl.org/id/ENSMUST00000143547.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000124228.2", "url": "https://www.ensembl.org/id/ENSMUSP00000124228.2" } ] } }, { "isoform_ac": "F6U250-1", "url": "", "sequence": { "sequence": "VSKLDAFPLCLWELGWHLVRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAVVQAEEAAAEITRKLEKQEKKRLKKEKK", "length": 135, "header": "tr|F6U250-1|F6U250_MOUSE Computationally mapped isoform of NOP56 ribonucleoprotein OS=Mus musculus OX=10090 GN=Nop56 PE=1 SV=1 CANONICAL=Q9D6Z1-1" }, "locus": { "chromosome": "2", "start_pos": 130120150, "end_pos": 130119235, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000159373.2", "url": "https://www.ensembl.org/id/ENSMUST00000159373.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000124080.2", "url": "https://www.ensembl.org/id/ENSMUSP00000124080.2" } ] } }, { "isoform_ac": "F6USW7-1", "url": "", "sequence": { "sequence": "XSMRVREWYGYHFPELVKIVNDNATYCRLAQFIGNRRELNEEKLEKLEEITMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEASPEDKG", "length": 125, "header": "tr|F6USW7-1|NOP56_MOUSE Computationally mapped isoform of Nucleolar protein 56 OS=Mus musculus OX=10090 GN=Nop56 PE=1 SV=1 CANONICAL=Q9D6Z1-1" }, "locus": { "chromosome": "2", "start_pos": 130119414, "end_pos": 130118079, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000149955.9", "url": "https://www.ensembl.org/id/ENSMUST00000149955.9" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000123879.2", "url": "https://www.ensembl.org/id/ENSMUSP00000123879.2" } ] } }, { "isoform_ac": "F6V095-1", "url": "", "sequence": { "sequence": "XNLTYTGLCYGGDGQSWCLSDSQGPAKGDRVSRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAVVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSTPEECEGGDRC", "length": 173, "header": "tr|F6V095-1|F6V095_MOUSE Computationally mapped isoform of NOP56 ribonucleoprotein OS=Mus musculus OX=10090 GN=Nop56 PE=1 SV=1 CANONICAL=Q9D6Z1-1" }, "locus": { "chromosome": "2", "start_pos": 130120348, "end_pos": 130119138, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000150401.8", "url": "https://www.ensembl.org/id/ENSMUST00000150401.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000123890.2", "url": "https://www.ensembl.org/id/ENSMUSP00000123890.2" } ] } }, { "isoform_ac": "F7CHP9-1", "url": "", "sequence": { "sequence": "XGYLRSEGLSVLLHVLFEHAVGYALLALKEVEEISLLLPQVEECVLNLGKFHNVVRLVAFCPFSSSQVALENANAVSEGVVHEDLRLLLETYLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRV", "length": 173, "header": "tr|F7CHP9-1|NOP56_MOUSE Computationally mapped isoform of Nucleolar protein 56 OS=Mus musculus OX=10090 GN=Nop56 PE=1 SV=1 CANONICAL=Q9D6Z1-1" }, "locus": { "chromosome": "2", "start_pos": 130118018, "end_pos": 130116412, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000141872.2", "url": "https://www.ensembl.org/id/ENSMUST00000141872.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000125305.2", "url": "https://www.ensembl.org/id/ENSMUSP00000125305.2" } ] } }, { "isoform_ac": "F7CHQ7-1", "url": "", "sequence": { "sequence": "XSAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAVVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSTPEECEGGDRC", "length": 222, "header": "tr|F7CHQ7-1|F7CHQ7_MOUSE Computationally mapped isoform of NOP56 ribonucleoprotein OS=Mus musculus OX=10090 GN=Nop56 PE=1 SV=1 CANONICAL=Q9D6Z1-1" }, "locus": { "chromosome": "2", "start_pos": 130120349, "end_pos": 130118637, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000146454.9", "url": "https://www.ensembl.org/id/ENSMUST00000146454.9" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000125304.2", "url": "https://www.ensembl.org/id/ENSMUSP00000125304.2" } ] } }, { "isoform_ac": "Q9D6Z1-1", "url": "", "sequence": { "sequence": "MVLLHVLFEHAVGYALLALKEVEEISLLLPQVEECVLNLGKFHNVVRLVAFCPFSSSQVALENANAVSEGVVHEDLRLLLETYLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIVNDNATYCRLAQFIGNRRELNEEKLEKLEEITMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAVVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSTPEECEEVNEKSKKKKKLKPQENGMEDPPVSLPKSKKKKAPKEELASDLEEMATSSAKRKKSSPKEEVASEPEEAASPTTPKKKRKFSEEPEVAANFTKSSTKKKKKSQKAQED", "length": 580, "header": "sp|Q9D6Z1-1|NOP56_MOUSE Isoform 1 of Nucleolar protein 56 OS=Mus musculus OX=10090 GN=Nop56 PE=1 SV=2 CANONICAL=Q9D6Z1-1" }, "locus": { "chromosome": "2", "start_pos": 130121140, "end_pos": 130116394, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000103198", "url": "https://www.ensembl.org/id/ENSMUST00000103198" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000099487", "url": "https://www.ensembl.org/id/ENSMUSP00000099487" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 564, "start_aa": "Thr", "end_pos": 564, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr564", "evidence": [ { "id": "Q9D6Z1", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9D6Z1" }, { "id": "34887587", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34887587" }, { "id": "25153642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153642" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" }, { "id": "29187734", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29187734" } ] } ], "phosphorylation": [ { "start_pos": 314, "end_pos": 314, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "site_lbl": "Ser314" }, { "start_pos": 465, "end_pos": 465, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "site_lbl": "Ser465" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "phospho.ELM", "id": "Q9D6Z1", "url": "http://phospho.elm.eu.org/byAccession/Q9D6Z1.html" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "site_lbl": "Ser466" }, { "start_pos": 467, "end_pos": 467, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "phospho.ELM", "id": "Q9D6Z1", "url": "http://phospho.elm.eu.org/byAccession/Q9D6Z1.html" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "site_lbl": "Thr467" }, { "start_pos": 513, "end_pos": 513, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "PubMed", "id": "18630941", "url": "https://glygen.org/publication/PubMed/18630941" }, { "database": "PubMed", "id": "19131326", "url": "https://glygen.org/publication/PubMed/19131326" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "Q9D6Z1", "url": "http://phospho.elm.eu.org/byAccession/Q9D6Z1.html" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" }, { "database": "PubMed", "id": "16452087", "url": "https://glygen.org/publication/PubMed/16452087" }, { "database": "PubMed", "id": "17203969", "url": "https://glygen.org/publication/PubMed/17203969" } ], "site_lbl": "Ser513" }, { "start_pos": 522, "end_pos": 522, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "site_lbl": "Ser522" }, { "start_pos": 528, "end_pos": 528, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "site_lbl": "Ser528" }, { "start_pos": 529, "end_pos": 529, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q9D6Z1", "url": "http://phospho.elm.eu.org/byAccession/Q9D6Z1.html" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ], "site_lbl": "Ser529" }, { "start_pos": 536, "end_pos": 536, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "PubMed", "id": "18630941", "url": "https://glygen.org/publication/PubMed/18630941" }, { "database": "PubMed", "id": "19131326", "url": "https://glygen.org/publication/PubMed/19131326" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "PubMed", "id": "16452087", "url": "https://glygen.org/publication/PubMed/16452087" }, { "database": "phospho.ELM", "id": "Q9D6Z1", "url": "http://phospho.elm.eu.org/byAccession/Q9D6Z1.html" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" }, { "database": "PubMed", "id": "17203969", "url": "https://glygen.org/publication/PubMed/17203969" } ], "site_lbl": "Ser536" }, { "start_pos": 543, "end_pos": 543, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "PubMed", "id": "19131326", "url": "https://glygen.org/publication/PubMed/19131326" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" }, { "database": "phospho.ELM", "id": "Q9D6Z1", "url": "http://phospho.elm.eu.org/byAccession/Q9D6Z1.html" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "site_lbl": "Ser543" }, { "start_pos": 545, "end_pos": 545, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "phospho.ELM", "id": "Q9D6Z1", "url": "http://phospho.elm.eu.org/byAccession/Q9D6Z1.html" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" }, { "database": "PubMed", "id": "17203969", "url": "https://glygen.org/publication/PubMed/17203969" } ], "site_lbl": "Thr545" }, { "start_pos": 546, "end_pos": 546, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "site_lbl": "Thr546" }, { "start_pos": 554, "end_pos": 554, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "Q9D6Z1", "url": "http://phospho.elm.eu.org/byAccession/Q9D6Z1.html" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "site_lbl": "Ser554" }, { "start_pos": 567, "end_pos": 567, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "site_lbl": "Ser567" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Box C/D snoRNA-associated proteins: two pairs of evolutionarily ancient proteins and possible links to replication and transcription.", "journal": "RNA", "date": "2000", "authors": "Maxwell E.S., Kuhn J.F., Newman D.R., Shanab G.M.", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "10864044", "url": "https://glygen.org/publication/PubMed/10864044" } ] }, { "title": "Comprehensive identification of phosphorylation sites in postsynaptic density preparations.", "journal": "Molecular & cellular proteomics : MCP", "date": "2006", "authors": "Trinidad JC, Specht CG, Thalhammer A, Schoepfer R, Burlingame AL", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "UniProtKB", "id": "A2APD7", "url": "https://www.uniprot.org/uniprot/A2APD7" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "16452087", "url": "https://glygen.org/publication/PubMed/16452087" } ] }, { "title": "Protein phosphorylation and expression profiling by Yin-yang multidimensional liquid chromatography (Yin-yang MDLC) mass spectrometry.", "journal": "Journal of proteome research", "date": "2007", "authors": "Dai J, Jin WH, Sheng QH, Shieh CH, Wu JR, Zeng R", "evidence": [ { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "17203969", "url": "https://glygen.org/publication/PubMed/17203969" } ] }, { "title": "Large-scale phosphorylation analysis of mouse liver.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Villen J, Beausoleil SA, Gerber SA, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "UniProtKB", "id": "A2APD7", "url": "https://www.uniprot.org/uniprot/A2APD7" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "17242355", "url": "https://glygen.org/publication/PubMed/17242355" } ] }, { "title": "Specific phosphopeptide enrichment with immobilized titanium ion affinity chromatography adsorbent for phosphoproteome analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Zhou H, Ye M, Dong J, Han G, Jiang X, Wu R, Zou H", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "UniProtKB", "id": "A2APD7", "url": "https://www.uniprot.org/uniprot/A2APD7" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "18630941", "url": "https://glygen.org/publication/PubMed/18630941" } ] }, { "title": "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Sweet SM, Bailey CM, Cunningham DL, Heath JK, Cooper HJ", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "19131326", "url": "https://glygen.org/publication/PubMed/19131326" } ] }, { "title": "The phagosomal proteome in interferon-gamma-activated macrophages.", "journal": "Immunity", "date": "2009", "authors": "Trost M, English L, Lemieux S, Courcelles M, Desjardins M, Thibault P", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "UniProtKB", "id": "A2APD7", "url": "https://www.uniprot.org/uniprot/A2APD7" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" }, { "database": "iPTMnet", "id": "Q9D6Z1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Expansion of intronic GGCCTG hexanucleotide repeat in NOP56 causes SCA36, a type of spinocerebellar ataxia accompanied by motor neuron involvement.", "journal": "Am. J. Hum. Genet.", "date": "2011", "authors": "Abe K., Ikeda Y., Kobayashi H., Liu W., Matsuura T., Koizumi A., Akechi Y., Habu T., Hitomi T., Okuda H.", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "21683323", "url": "https://glygen.org/publication/PubMed/21683323" } ] }, { "title": "Early and selective reduction of NOP56 (Asidan) and RNA processing proteins in the motor neuron of ALS model mice.", "journal": "Neurological research", "date": "2013", "authors": "Miyazaki K, Yamashita T, Morimoto N, Sato K, Mimoto T, Kurata T, Ikeda Y, Abe K", "evidence": [ { "database": "RefSeq", "id": "NP_077155", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077155" } ], "reference": [ { "type": "PubMed", "id": "23582672", "url": "https://glygen.org/publication/PubMed/23582672" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "A2APD7", "url": "https://www.uniprot.org/uniprot/A2APD7" }, { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Changes in metabolic chemical reporter structure yield a selective probe of O-GlcNAc modification.", "journal": "Journal of the American Chemical Society", "date": "2014", "authors": "Chuh KN, Zaro BW, Piller F, Piller V, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9D6Z1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "25153642", "url": "https://glygen.org/publication/PubMed/25153642" } ] }, { "title": "O-GlcNAcylation is required for B cell homeostasis and antibody responses.", "journal": "Nature communications", "date": "2017", "authors": "Wu JL, Chiang MF, Hsu PH, Tsai DY, Hung KH, Wang YH, Angata T, Lin KI", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9D6Z1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "29187734", "url": "https://glygen.org/publication/PubMed/29187734" } ] }, { "title": "Dynamic eIF3a O-GlcNAcylation controls translation reinitiation during nutrient stress.", "journal": "Nature chemical biology", "date": "2022", "authors": "Shu XE, Mao Y, Jia L, Qian SB", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9D6Z1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "34887587", "url": "https://glygen.org/publication/PubMed/34887587" } ] }, { "title": "Chemoproteomic and Transcriptomic Analysis Reveals that O-GlcNAc Regulates Mouse Embryonic Stem Cell Fate through the Pluripotency Network.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2023-02-27", "authors": "Hao Yi, Li Xiang, Qin Ke, Shi Yujie, He Yanwen, Zhang Che, Cheng Bo, Zhang Xiwen, Hu Guangyu, Liang Shuyu, Tang Qi, Chen Xing", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9D6Z1", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9D6Z1" } ], "reference": [ { "type": "PubMed", "id": "36852467", "url": "https://glygen.org/publication/PubMed/36852467" } ] } ], "pathway": [ { "id": "mmu:67134", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67134", "resource": "KEGG Pathway" }, { "id": "R-MMU-6791226", "name": "Major pathway of rRNA processing in the nucleolus and cytosol", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6791226", "resource": "Reactome", "description": "Major pathway of rRNA processing in the nucleolus and cytosol" } ], "orthologs": [ { "uniprot_canonical_ac": "O00567-1", "protein_name": "Nucleolar protein 56", "gene_name": "NOP56", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVLLHVLFEHAVGYALLALKEVEEISLLQPQVEESVLNLGKFHSIVRLVAFCPFASSQVALENANAVSEGVVHEDLRLLLETHLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIINDNATYCRLAQFIGNRRELNEDKLEKLEELTMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAMVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSSTPEECEEMSEKPKKKKKQKPQEVPQENGMEDPSISFSKPKKKKSFSKEELMSSDLEETAGSTSIPKRKKSTPKEETVNDPEEAGHRSGSKKKRKFSKEEPVSSGPEEAVGKSSSKKKKKFHKASQED", "length": 594 }, "evidence": [ { "id": "45225511", "url": "http://www.informatics.jax.org/homology/45225511", "database": "MGI" }, { "id": "Q9D6Z1", "url": "https://omabrowser.org/oma/group/Q9D6Z1/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q12460-1", "protein_name": "Nucleolar protein 56", "gene_name": "NOP56", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MAPIEYLLFEEPTGYAVFKVKLQQDDIGSRLKEVQEQINDFGAFTKLIELVSFAPFKGAAEALENANDISEGLVSESLKAILDLNLPKASSKKKNITLAISDKNLGPSIKEEFPYVDCISNELAQDLIRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRAKVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLVLFIKDKASLNDDSLHDLAALLNEDSGIAQRVIDNARISMGQDISETDMENVCVFAQRVASLADYRRQLYDYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQILGAEKALFRALKTKGNTPKYGLIYHSGFISKASAKNKGRISRYLANKCSMASRIDNYSEEPSNVFGSVLKKQVEQRLEFYNTGKPTLKNELAIQEAMELYNKDKPAAEVEETKEKESSKKRKLEDDDEEKKEKKEKKSKKEKKEKKEKKDKKEKKDKKEKKDKKKKSKD", "length": 504 }, "evidence": [ { "id": "Q9D6Z1", "url": "https://omabrowser.org/oma/group/Q9D6Z1/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q4KLK7-1", "protein_name": "NOP56 ribonucleoprotein", "gene_name": "Nop56", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MVLLHVLFEHAVGYALLALKEVEEISLLLPQVEECVLNLGKFHNVVRLVAFCPFSSSQVALENANAVSEGVVHEDLRLLLETYLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIINDNATYCRLAQFIGNRRELNEEKLEKLEEITMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHNYLRSKMSQVAPSLSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAVVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSTPEECEEVNEKPKKKKLKPQETLQENGMEDPPVSLPKTKKKKAFPKEELASDLEEMATSSISVPKKKKSLPKEEVASEPEEAASPITPKKKRKFSEEPEAAASCTKSSTKKKKKSQKAREED", "length": 588 }, "evidence": [ { "id": "45225511", "url": "http://www.informatics.jax.org/homology/45225511", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "snoRNA binding", "id": "GO:0030515", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030515", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" }, { "name": "histone methyltransferase binding", "id": "GO:1990226", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990226", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "box C/D RNP complex", "id": "GO:0031428", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031428", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" }, { "name": "small-subunit processome", "id": "GO:0032040", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032040", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" }, { "name": "fibrillar center", "id": "GO:0001650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001650", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" }, { "name": "pre-snoRNP complex", "id": "GO:0070761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070761", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" }, { "name": "sno(s)RNA-containing ribonucleoprotein complex", "id": "GO:0005732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005732", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "ribosomal small subunit biogenesis", "id": "GO:0042274", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042274", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" }, { "name": "ribosome biogenesis", "id": "GO:0042254", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042254", "evidence": [ { "database": "UniProtKB", "id": "Q9D6Z1", "url": "https://www.uniprot.org/uniprot/Q9D6Z1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 207, "end_pos": 209, "annotation": "n_glycosylation_sequon" }, { "start_pos": 464, "end_pos": 466, "annotation": "n_glycosylation_sequon" }, { "start_pos": 562, "end_pos": 564, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 14 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }