{ "uniprot_canonical_ac": "Q9D6W7-1", "uniprot_ac": "Q9D6W7", "uniprot_id": "C16L2_MOUSE", "mass": { "chemical_mass": 18220.0, "monoisotopic_mass": 18220.0 }, "refseq": { "ac": "NP_081428", "name": "CD164 sialomucin-like 2 protein precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081428" }, "gene_names": [ { "name": "Cd164l2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9D6W7", "id": "Q9D6W7" }, { "name": "2310047N01Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081428", "id": "NP_081428" }, { "name": "Cd164l2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081428", "id": "NP_081428" } ], "protein_names": [ { "name": "CD164 sialomucin-like 2 protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9D6W7" }, { "name": "CD164 sialomucin-like 2 protein precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081428", "id": "NP_081428" }, { "name": "D164 sialomucin-like 2; CD164 sialomucin-like 2 protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081428", "id": "NP_081428" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D6W7", "url": "https://www.uniprot.org/uniprot/Q9D6W7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cd164l2", "url": "https://www.uniprot.org/uniprot/Q9D6W7", "locus": { "chromosome": "4", "start_pos": 132951866, "end_pos": 132939442, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000028865", "url": "https://www.ensembl.org/id/ENSMUSG00000028865" } ] } } ], "crossref": [ { "id": "ENSMUSG00000028865", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000028865", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "69655", "url": "https://www.ncbi.nlm.nih.gov/gene/69655", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007947", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007947", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:69655", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69655", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1916905", "url": "http://www.informatics.jax.org/marker/MGI:1916905", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9D6W7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9D6W7", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "AVQGGCK", "url": "https://omabrowser.org/oma/group/AVQGGCK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5361963at2759", "url": "http://www.orthodb.org/?query=5361963at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11337", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11337", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11337:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11337:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05283", "url": "http://pfam.xfam.org/family/PF05283", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9D6W7", "url": "http://purl.obolibrary.org/obo/PR_Q9D6W7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_081428", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081428", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9D6W7", "url": "https://www.uniprot.org/uniprot/Q9D6W7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D6W7-1", "url": "https://www.uniprot.org/uniprot/Q9D6W7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAPGPRALRAALCGGCCCLLLCAQLVLAGKGARGFGRGALLRLNVWPTTQGGCKHLGHCEHCVDRAHNFSICVWQQCGPEEPGHCVAQAEVVKEGCSIYNHSESCPASHHHSTEEPKPSTTGSPPIPEDHSPGFDGASFIGGIVLVLSLQATAFFVLRFLKAKDSTYQTLI", "length": 172, "header": "sp|Q9D6W7-1|C16L2_MOUSE Isoform 1 of CD164 sialomucin-like 2 protein OS=Mus musculus OX=10090 GN=Cd164l2 PE=2 SV=1 CANONICAL=Q9D6W7-1" }, "isoforms": [ { "isoform_ac": "Q9D6W7-1", "url": "", "sequence": { "sequence": "MAAPGPRALRAALCGGCCCLLLCAQLVLAGKGARGFGRGALLRLNVWPTTQGGCKHLGHCEHCVDRAHNFSICVWQQCGPEEPGHCVAQAEVVKEGCSIYNHSESCPASHHHSTEEPKPSTTGSPPIPEDHSPGFDGASFIGGIVLVLSLQATAFFVLRFLKAKDSTYQTLI", "length": 172, "header": "sp|Q9D6W7-1|C16L2_MOUSE Isoform 1 of CD164 sialomucin-like 2 protein OS=Mus musculus OX=10090 GN=Cd164l2 PE=2 SV=1 CANONICAL=Q9D6W7-1" }, "locus": { "chromosome": "4", "start_pos": 132951566, "end_pos": 132948291, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105910", "url": "https://www.ensembl.org/id/ENSMUST00000105910" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101530", "url": "https://www.ensembl.org/id/ENSMUSP00000101530" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 101, "start_aa": "Asn", "end_pos": 101, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn101", "evidence": [ { "id": "Q9D6W7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D6W7#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 167, "start_aa": "Thr", "end_pos": 167, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr167", "evidence": [ { "id": "Q9D6W7", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9D6W7" }, { "id": "34418053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34418053" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 69, "start_aa": "Asn", "end_pos": 69, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn69", "evidence": [ { "id": "Q9D6W7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D6W7#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "O-GlcNAcylation Is Essential for Rapid Pomc Expression and Cell Proliferation in Corticotropic Tumor Cells.", "journal": "Endocrinology", "date": "2021", "authors": "Massman LJ, Pereckas M, Zwagerman NT, Olivier-Van Stichelen S", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9D6W7", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9D6W7" } ], "reference": [ { "type": "PubMed", "id": "34418053", "url": "https://glygen.org/publication/PubMed/34418053" } ] } ], "pathway": [ { "id": "mmu:69655", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69655", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZGM0-1", "protein_name": "CD164 molecule like 2", "gene_name": "Cd164l2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAPGPRALRAALCGGCCCLLLCAQLVLAGKGARGFGRGALLHLNIWPAAHGGCKHLGHCERCVDRAHNSSICVWQQCGPEEPGHCVAHTEVVKEGCSVYNHSESCPASHHHSTEEPKTSTTGSPPIPEDHSPGFDGASFIGGIVLVLSLQATAFFVLRFLKAKDSTYQTLI", "length": 172 }, "evidence": [ { "id": "45235510", "url": "http://www.informatics.jax.org/homology/45235510", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6UWJ8-1", "protein_name": "CD164 sialomucin-like 2 protein", "gene_name": "CD164L2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEAPGPRALRTALCGGCCCLLLCAQLAVAGKGARGFGRGALIRLNIWPAVQGACKQLEVCEHCVEGDGARNLSSCVWEQCRPEEPGHCVAQSEVVKEGCSIYNRSEACPAAHHHPTYEPKTVTTGSPPVPEAHSPGFDGASFIGGVVLVLSLQAVAFFVLHFLKAKDSTYQTLI", "length": 174 }, "evidence": [ { "id": "45235510", "url": "http://www.informatics.jax.org/homology/45235510", "database": "MGI" }, { "id": "Q9D6W7", "url": "https://omabrowser.org/oma/group/Q9D6W7/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9D6W7", "url": "https://www.uniprot.org/uniprot/Q9D6W7" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "Q9D6W7", "url": "https://www.uniprot.org/uniprot/Q9D6W7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 101, "end_pos": 103, "annotation": "n_glycosylation_sequon" }, { "start_pos": 69, "end_pos": 71, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }