{ "uniprot_canonical_ac": "Q9D3X8-1", "uniprot_ac": "Q9D3X8", "uniprot_id": "Q9D3X8_MOUSE", "mass": { "chemical_mass": 15933.0, "monoisotopic_mass": 15933.0 }, "refseq": { "ac": "NP_081993", "name": "DPY30 domain-containing protein 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081993" }, "gene_names": [ { "name": "Dydc2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9D3X8", "id": "Q9D3X8" }, { "name": "4933428D01Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081993", "id": "NP_081993" }, { "name": "Dydc2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081993", "id": "NP_081993" } ], "protein_names": [ { "name": "DPY30 domain containing 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D3X8" }, { "name": "DPY30 domain-containing protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081993", "id": "NP_081993" } ], "function": [ { "annotation": "Dydc2 is most abundantly expressed in tissues rich in highly ciliated cells, such as olfactory sensory neurons, and is predicted to be important to cilia.", "evidence": [ { "database": "RefSeq", "id": "NP_081993", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081993" }, { "database": "PubMed", "id": "17971504", "url": "https://glygen.org/publication/PubMed/17971504" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D3X8", "url": "https://www.uniprot.org/uniprot/Q9D3X8" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Dydc2", "url": "https://www.uniprot.org/uniprot/Q9D3X8", "locus": { "chromosome": "14", "start_pos": 40771074, "end_pos": 40791165, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000021791", "url": "https://www.ensembl.org/id/ENSMUSG00000021791" } ] } } ], "crossref": [ { "id": "ENSMUSG00000021791", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000021791", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd22966", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22966", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "71200", "url": "https://www.ncbi.nlm.nih.gov/gene/71200", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007858", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007858", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037856", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037856", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "1918450", "url": "http://www.informatics.jax.org/marker/MGI:1918450", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "AHWLYHH", "url": "https://omabrowser.org/oma/group/AHWLYHH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5491730at2759", "url": "http://www.orthodb.org/?query=5491730at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23356", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23356", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23356:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23356:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05186", "url": "http://pfam.xfam.org/family/PF05186", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "NP_081993", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081993", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9D3X8", "url": "https://www.uniprot.org/uniprot/Q9D3X8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D3X8-1", "url": "https://www.uniprot.org/uniprot/Q9D3X8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDTAYLKNCFGTGLTQALAEVARVRPSDPIEYLAHWLYHYRSITVAEEKRRQEELQLKEARDRSAEEAKTTEMLKEEGYQIQQKCEKCHQELPSTSFSSDKTPALQEDTAPLEEKTMRQESQPGASRVISEMPQRAIPS", "length": 139, "header": "tr|Q9D3X8-1|Q9D3X8_MOUSE Isoform 1 of DPY30 domain containing 2 OS=Mus musculus OX=10090 GN=Dydc2 PE=1 SV=1 CANONICAL=Q9D3X8-1" }, "isoforms": [ { "isoform_ac": "Q9D3X8-1", "url": "", "sequence": { "sequence": "MDTAYLKNCFGTGLTQALAEVARVRPSDPIEYLAHWLYHYRSITVAEEKRRQEELQLKEARDRSAEEAKTTEMLKEEGYQIQQKCEKCHQELPSTSFSSDKTPALQEDTAPLEEKTMRQESQPGASRVISEMPQRAIPS", "length": 139, "header": "tr|Q9D3X8-1|Q9D3X8_MOUSE Isoform 1 of DPY30 domain containing 2 OS=Mus musculus OX=10090 GN=Dydc2 PE=1 SV=1 CANONICAL=Q9D3X8-1" }, "locus": { "chromosome": "14", "start_pos": 40784452, "end_pos": 40771261, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000022316.6", "url": "https://www.ensembl.org/id/ENSMUST00000022316.6" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000022316.5", "url": "https://www.ensembl.org/id/ENSMUSP00000022316.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Tissue expression patterns identify mouse cilia genes.", "journal": "Physiological genomics", "date": "2008", "authors": "McClintock TS, Glasser CE, Bose SC, Bergman DA", "evidence": [ { "database": "RefSeq", "id": "NP_081993", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081993" } ], "reference": [ { "type": "PubMed", "id": "17971504", "url": "https://glygen.org/publication/PubMed/17971504" } ] } ], "pathway": [], "orthologs": [ { "uniprot_canonical_ac": "F8WFN8-1", "protein_name": "DPY30 domain containing 2", "gene_name": "Dydc2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "METAYLKKCFGNTLTQALAEVARVQPNDPIEYLAHWLYHHRNITKAEEKKKQEELQLQEVHDSNSKEAKATATLKEGSYQIKQKCEKRHQELPSTSVSSDQTPALQEDLALREEKSTRQEAPPGVSNVITKTPQSAIPS", "length": 139 }, "evidence": [ { "id": "45235057", "url": "http://www.informatics.jax.org/homology/45235057", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q96IM9-1", "protein_name": "DPY30 domain-containing protein 2", "gene_name": "DYDC2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF", "length": 177 }, "evidence": [ { "id": "45235057", "url": "http://www.informatics.jax.org/homology/45235057", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "Set1C/COMPASS complex", "id": "GO:0048188", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048188", "evidence": [ { "database": "UniProtKB", "id": "Q9D3X8", "url": "https://www.uniprot.org/uniprot/Q9D3X8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }