{ "uniprot_canonical_ac": "Q9D3P8-1", "uniprot_ac": "Q9D3P8", "uniprot_id": "PLRKT_MOUSE", "mass": { "chemical_mass": 17261.0, "monoisotopic_mass": 17261.0 }, "refseq": { "ac": "NP_080638", "name": "plasminogen receptor (KT)", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" }, "gene_names": [ { "name": "Plgrkt", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9D3P8", "id": "Q9D3P8" }, { "name": "1110007H22Rik; 5033414D02Rik; Plg-R(KT); Plg-RKT", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638", "id": "NP_080638" }, { "name": "5033414D02Rik", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9D3P8", "id": "Q9D3P8" }, { "name": "Plgrkt", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638", "id": "NP_080638" } ], "protein_names": [ { "name": "Plasminogen receptor (KT)", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9D3P8" }, { "name": "Plg-R(KT)", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D3P8" }, { "name": "plasminogen receptor (KT)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638", "id": "NP_080638" }, { "name": "transmembrane protein C9orf46 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638", "id": "NP_080638" } ], "function": [ { "annotation": "Exposure of plasminogen and a novel plasminogen receptor, Plg-RKT, on activated human and murine platelets.", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" }, { "database": "PubMed", "id": "32842150", "url": "https://glygen.org/publication/PubMed/32842150" } ] }, { "annotation": "Plasminogen and the Plasminogen Receptor, Plg-RKT, Regulate Macrophage Phenotypic, and Functional Changes. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" }, { "database": "PubMed", "id": "31316511", "url": "https://glygen.org/publication/PubMed/31316511" } ] }, { "annotation": "Plg-R(KT) plays a key role in the plasminogen-dependent regulation of macrophage invasion, chemotactic migration, and recruitment in the inflammatory response.", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" }, { "database": "PubMed", "id": "21940822", "url": "https://glygen.org/publication/PubMed/21940822" } ] }, { "annotation": "Plg-R(KT) was highly expressed in bovine adrenomedullary chromaffin cells, human pheochromocytoma tissue, PC12 pheochromocytoma cells, and murine hippocampus.", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" }, { "database": "PubMed", "id": "21795689", "url": "https://glygen.org/publication/PubMed/21795689" } ] }, { "annotation": "Plg-RKT is essential for lactogenesis and functions to maintain the appropriate stromal extracellular matrix environment, regulate epithelial cell proliferation and apoptosis, and, by regulating fibrinolysis, preserve alveolar and ductal patency.", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" }, { "database": "PubMed", "id": "29495105", "url": "https://glygen.org/publication/PubMed/29495105" } ] }, { "annotation": "Receptor for plasminogen. Regulates urokinase plasminogen activator-dependent and stimulates tissue-type plasminogen activator-dependent cell surface plasminogen activation. Proposed to be part of a local catecholaminergic cell plasminogen activation system that regulates neuroendocrine prohormone processing. Involved in regulation of inflammatory response; regulates monocyte chemotactic migration and matrix metalloproteinase activation, such as of MMP2 and MMP9.", "evidence": [ { "database": "UniProtKB", "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8#function" }, { "database": "PubMed", "id": "21940822", "url": "https://glygen.org/publication/PubMed/21940822" }, { "database": "PubMed", "id": "19897580", "url": "https://glygen.org/publication/PubMed/19897580" }, { "database": "PubMed", "id": "21795689", "url": "https://glygen.org/publication/PubMed/21795689" } ] }, { "annotation": "The plasminogen receptor Plg-RKT regulates adipose function and metabolic homeostasis.", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" }, { "database": "PubMed", "id": "34897983", "url": "https://glygen.org/publication/PubMed/34897983" } ] }, { "annotation": "The plasminogen receptor, Plg-RKT, plays a role in inflammation and fibrinolysis during cutaneous wound healing in mice. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" }, { "database": "PubMed", "id": "33311441", "url": "https://glygen.org/publication/PubMed/33311441" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 147, "end_pos": 147, "sequence_org": "K", "sequence_mut": "A", "comment": "Disrupts binding to plasminogen.", "evidence": [ { "database": "UniProtKB", "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8" }, { "database": "PubMed", "id": "19897580", "url": "https://glygen.org/publication/PubMed/19897580" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Plgrkt", "url": "https://www.uniprot.org/uniprot/Q9D3P8", "locus": { "chromosome": "19", "start_pos": 29325999, "end_pos": 29344790, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000016495", "url": "https://www.ensembl.org/id/ENSMUSG00000016495" } ] } } ], "crossref": [ { "id": "ENSMUSG00000016495", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000016495", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "67759", "url": "https://www.ncbi.nlm.nih.gov/gene/67759", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9D3P8", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9D3P8*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR019319", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019319", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:67759", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67759", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1915009", "url": "http://www.informatics.jax.org/marker/MGI:1915009", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "MIMEHEQ", "url": "https://omabrowser.org/oma/group/MIMEHEQ/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5471730at2759", "url": "http://www.orthodb.org/?query=5471730at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13411", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13411", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13411:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13411:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF10166", "url": "http://pfam.xfam.org/family/PF10166", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9D3P8", "url": "http://purl.obolibrary.org/obo/PR_Q9D3P8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1Y7VE20", "url": "https://www.uniprot.org/uniprot/A0A1Y7VE20", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1Y7VE20-1", "url": "https://www.uniprot.org/uniprot/A0A1Y7VE20-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YV19", "url": "https://www.uniprot.org/uniprot/D3YV19", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YV19-1", "url": "https://www.uniprot.org/uniprot/D3YV19-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YXU2", "url": "https://www.uniprot.org/uniprot/D3YXU2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YXU2-1", "url": "https://www.uniprot.org/uniprot/D3YXU2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YY76", "url": "https://www.uniprot.org/uniprot/D3YY76", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YY76-1", "url": "https://www.uniprot.org/uniprot/D3YY76-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D3P8-1", "url": "https://www.uniprot.org/uniprot/Q9D3P8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGFIFSKSMNENMKNQQEFMVTHARLQLERHLTMQNEMRERQMAMQIAWSREFLKYFGTFFGIATISLATGALKRKKPAFLVPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTKLELPKGLITFESLEKARREQSKLFSDK", "length": 147, "header": "sp|Q9D3P8-1|PLRKT_MOUSE Isoform 1 of Plasminogen receptor (KT) OS=Mus musculus OX=10090 GN=Plgrkt PE=1 SV=1 CANONICAL=Q9D3P8-1" }, "isoforms": [ { "isoform_ac": "A0A1Y7VE20-1", "url": "", "sequence": { "sequence": "MGFIFSK", "length": 7, "header": "tr|A0A1Y7VE20-1|PLRKT_MOUSE Computationally mapped isoform of Plasminogen receptor (KT) OS=Mus musculus OX=10090 GN=Plgrkt PE=1 SV=1 CANONICAL=Q9D3P8-1" }, "locus": { "chromosome": "19", "start_pos": 29335797, "end_pos": 29335777, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000138051.2", "url": "https://www.ensembl.org/id/ENSMUST00000138051.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000118559.2", "url": "https://www.ensembl.org/id/ENSMUSP00000118559.2" } ] } }, { "isoform_ac": "D3YV19-1", "url": "", "sequence": { "sequence": "MGFIFSKSMNENMKNQQEFMVTHARLQVKLRTYWKQKRRSWSCQKD", "length": 46, "header": "tr|D3YV19-1|D3YV19_MOUSE Computationally mapped isoform of Plasminogen receptor, C-terminal lysine transmembrane protein OS=Mus musculus OX=10090 GN=Plgrkt PE=1 SV=1 CANONICAL=Q9D3P8-1" }, "locus": { "chromosome": "19", "start_pos": 29335797, "end_pos": 29326349, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000152936.8", "url": "https://www.ensembl.org/id/ENSMUST00000152936.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114754.2", "url": "https://www.ensembl.org/id/ENSMUSP00000114754.2" } ] } }, { "isoform_ac": "D3YXU2-1", "url": "", "sequence": { "sequence": "MGFIFSKSMNENMKNQQEFMVTHARLQLERHLTMQNEMRERQ", "length": 42, "header": "tr|D3YXU2-1|D3YXU2_MOUSE Computationally mapped isoform of Plasminogen receptor, C-terminal lysine transmembrane protein OS=Mus musculus OX=10090 GN=Plgrkt PE=1 SV=1 CANONICAL=Q9D3P8-1" }, "locus": { "chromosome": "19", "start_pos": 29335797, "end_pos": 29328530, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000126800.8", "url": "https://www.ensembl.org/id/ENSMUST00000126800.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000118295.2", "url": "https://www.ensembl.org/id/ENSMUSP00000118295.2" } ] } }, { "isoform_ac": "D3YY76-1", "url": "", "sequence": { "sequence": "MGFIFSKSMNENMKNQQEFMVTHARLQLERHLTMQNEMRERQMAMQIAWSREFLKYFGTFFGIATISLATGYAL", "length": 74, "header": "tr|D3YY76-1|D3YY76_MOUSE Computationally mapped isoform of Plasminogen receptor, C-terminal lysine transmembrane protein OS=Mus musculus OX=10090 GN=Plgrkt PE=1 SV=1 CANONICAL=Q9D3P8-1" }, "locus": { "chromosome": "19", "start_pos": 29335797, "end_pos": 29328434, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000155367.8", "url": "https://www.ensembl.org/id/ENSMUST00000155367.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000118861.2", "url": "https://www.ensembl.org/id/ENSMUSP00000118861.2" } ] } }, { "isoform_ac": "Q9D3P8-1", "url": "", "sequence": { "sequence": "MGFIFSKSMNENMKNQQEFMVTHARLQLERHLTMQNEMRERQMAMQIAWSREFLKYFGTFFGIATISLATGALKRKKPAFLVPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTKLELPKGLITFESLEKARREQSKLFSDK", "length": 147, "header": "sp|Q9D3P8-1|PLRKT_MOUSE Isoform 1 of Plasminogen receptor (KT) OS=Mus musculus OX=10090 GN=Plgrkt PE=1 SV=1 CANONICAL=Q9D3P8-1" }, "locus": { "chromosome": "19", "start_pos": 29335797, "end_pos": 29326287, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000016639", "url": "https://www.ensembl.org/id/ENSMUST00000016639" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000016639", "url": "https://www.ensembl.org/id/ENSMUSP00000016639" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Proteomics-based discovery of a novel, structurally unique, and developmentally regulated plasminogen receptor, Plg-RKT, a major regulator of cell surface plasminogen activation.", "journal": "Blood", "date": "2010", "authors": "Andronicos NM, Chen EI, Baik N, Bai H, Parmer CM, Kiosses WB, Kamps MP, Yates JR 3rd, Parmer RJ, Miles LA", "evidence": [ { "database": "UniProtKB", "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8" } ], "reference": [ { "type": "PubMed", "id": "19897580", "url": "https://glygen.org/publication/PubMed/19897580" } ] }, { "title": "The novel plasminogen receptor, plasminogen receptor(KT) (Plg-R(KT)), regulates catecholamine release.", "journal": "J. Biol. Chem.", "date": "2011", "authors": "Bai H, Baik N, Kiosses WB, Krajewski S, Miles LA, Parmer RJ", "evidence": [ { "database": "UniProtKB", "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8" }, { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" } ], "reference": [ { "type": "PubMed", "id": "21795689", "url": "https://glygen.org/publication/PubMed/21795689" } ] }, { "title": "Regulation of macrophage migration by a novel plasminogen receptor Plg-R KT.", "journal": "Blood", "date": "2011", "authors": "Lighvani S, Baik N, Diggs JE, Khaldoyanidi S, Parmer RJ, Miles LA", "evidence": [ { "database": "UniProtKB", "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8" }, { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" } ], "reference": [ { "type": "PubMed", "id": "21940822", "url": "https://glygen.org/publication/PubMed/21940822" } ] }, { "title": "The plasminogen receptor, Plg-RKT, is essential for mammary lobuloalveolar development and lactation.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2018", "authors": "Miles LA, Baik N, Bai H, Makarenkova HP, Kiosses WB, Krajewski S, Castellino FJ, Valenzuela A, Varki NM, Mueller BM, Parmer RJ", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" } ], "reference": [ { "type": "PubMed", "id": "29495105", "url": "https://glygen.org/publication/PubMed/29495105" } ] }, { "title": "Plasminogen and the Plasminogen Receptor, Plg-RKT, Regulate Macrophage Phenotypic, and Functional Changes.", "journal": "Frontiers in immunology", "date": "2019", "authors": "Vago JP, Sugimoto MA, Lima KM, Negreiros-Lima GL, Baik N, Teixeira MM, Perretti M, Parmer RJ, Miles LA, Sousa LP", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" } ], "reference": [ { "type": "PubMed", "id": "31316511", "url": "https://glygen.org/publication/PubMed/31316511" } ] }, { "title": "Exposure of plasminogen and a novel plasminogen receptor, Plg-RKT, on activated human and murine platelets.", "journal": "Blood", "date": "2021", "authors": "Whyte CS, Morrow GB, Baik N, Booth NA, Jalal MM, Parmer RJ, Miles LA, Mutch NJ", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" } ], "reference": [ { "type": "PubMed", "id": "32842150", "url": "https://glygen.org/publication/PubMed/32842150" } ] }, { "title": "The plasminogen receptor, Plg-RKT, plays a role in inflammation and fibrinolysis during cutaneous wound healing in mice.", "journal": "Cell death & disease", "date": "2020", "authors": "Ny L, Parmer RJ, Shen Y, Holmberg S, Baik N, Backman A, Broden J, Wilczynska M, Ny T, Miles LA", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" } ], "reference": [ { "type": "PubMed", "id": "33311441", "url": "https://glygen.org/publication/PubMed/33311441" } ] }, { "title": "The plasminogen receptor Plg-R(KT) regulates adipose function and metabolic homeostasis.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2022", "authors": "Samad F, Bai H, Baik N, Haider P, Zhang Y, Rega-Kaun G, Kaun C, Prager M, Wojta J, Bui Q, Chakrabarty S, Wang J, Parmer RJ, Miles LA", "evidence": [ { "database": "RefSeq", "id": "NP_080638", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080638" } ], "reference": [ { "type": "PubMed", "id": "34897983", "url": "https://glygen.org/publication/PubMed/34897983" } ] } ], "pathway": [ { "id": "mmu:67759", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67759", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D4ACN8-1", "protein_name": "Plasminogen receptor (KT)", "gene_name": "Plgrkt", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGFIFSKSMNENMKNQQEFMVMHARLQLERQLIMQNEMRERQMAMQIAWSREFLKYFGTFFGIATISLAAGAIKRKKPAFLIPIVPLSFIFTYQYDLGYGTLLQRMKSEAEDILETEKTKLELPKGLITFESLEKARREQSKFFSDK", "length": 147 }, "evidence": [ { "id": "45236598", "url": "http://www.informatics.jax.org/homology/45236598", "database": "MGI" }, { "id": "Q9D3P8", "url": "https://omabrowser.org/oma/group/Q9D3P8/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9HBL7-1", "protein_name": "Plasminogen receptor (KT)", "gene_name": "PLGRKT", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTFFGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK", "length": 147 }, "evidence": [ { "id": "45236598", "url": "http://www.informatics.jax.org/homology/45236598", "database": "MGI" }, { "id": "Q9D3P8", "url": "https://omabrowser.org/oma/group/Q9D3P8/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "positive regulation of plasminogen activation", "id": "GO:0010756", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010756", "evidence": [ { "database": "UniProtKB", "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8" } ], "pmid": "" }, { "name": "chemotaxis", "id": "GO:0006935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935", "evidence": [ { "database": "UniProtKB", "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8" } ], "pmid": "" }, { "name": "inflammatory response", "id": "GO:0006954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006954", "evidence": [ { "database": "UniProtKB", "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9D3P8", "url": "https://www.uniprot.org/uniprot/Q9D3P8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }