{ "uniprot_canonical_ac": "Q9D387-1", "uniprot_ac": "Q9D387", "uniprot_id": "LAMP5_MOUSE", "mass": { "chemical_mass": 31721.0, "monoisotopic_mass": 31721.0 }, "refseq": { "ac": "NP_083806", "name": "lysosome-associated membrane glycoprotein 5 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083806" }, "gene_names": [ { "name": "Lamp5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9D387", "id": "Q9D387" }, { "name": "3110035N03Rik; 6330527O06Rik; BAD-LAMP; LAMP-5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083806", "id": "NP_083806" }, { "name": "6330527O06Rik", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9D387", "id": "Q9D387" }, { "name": "Lamp5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083806", "id": "NP_083806" } ], "protein_names": [ { "name": "Lysosome-associated membrane glycoprotein 5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9D387" }, { "name": "BAD-LAMP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D387" }, { "name": "Brain and dendritic cell-associated LAMP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D387" }, { "name": "Brain-associated LAMP-like protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D387" }, { "name": "LAMP family protein C20orf103 homolog; Protein C20orf103; brain-associated LAMP-like protein; lysosome-associated membrane protein 5; brain and dendritic cell-associated LAMP; lysosome-associated membrane glycoprotein 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083806", "id": "NP_083806" }, { "name": "LAMP-5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D387" }, { "name": "Lysosome-associated membrane protein 5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D387" }, { "name": "lysosome-associated membrane glycoprotein 5 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083806", "id": "NP_083806" } ], "function": [ { "annotation": "Loss of LAMP5 interneurons drives neuronal network dysfunction in Alzheimer's disease.", "evidence": [ { "database": "RefSeq", "id": "NP_083806", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083806" }, { "database": "PubMed", "id": "35780436", "url": "https://glygen.org/publication/PubMed/35780436" } ] }, { "annotation": "Plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain.", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387#function" }, { "database": "PubMed", "id": "27272053", "url": "https://glygen.org/publication/PubMed/27272053" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 276, "end_pos": 276, "sequence_org": "Y", "sequence_mut": "A", "comment": "Cell surface localization.", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" }, { "database": "PubMed", "id": "17215451", "url": "https://glygen.org/publication/PubMed/17215451" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Lamp5", "url": "https://www.uniprot.org/uniprot/Q9D387", "locus": { "chromosome": "2", "start_pos": 135911837, "end_pos": 135894159, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000027270", "url": "https://www.ensembl.org/id/ENSMUSG00000027270" } ] } } ], "crossref": [ { "id": "ENSMUSG00000027270", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000027270", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "76161", "url": "https://www.ncbi.nlm.nih.gov/gene/76161", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2496", "url": "https://glyconnect.expasy.org/browser/proteins/2496", "database": "GlyConnect", "categories": [ "Glycan", "Glycoproteomics" ] }, { "id": "IPR002000", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002000", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018134", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018134", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:76161", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:76161", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1923411", "url": "http://www.informatics.jax.org/marker/MGI:1923411", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "HTVTRIM", "url": "https://omabrowser.org/oma/group/HTVTRIM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5354428at2759", "url": "http://www.orthodb.org/?query=5354428at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11506", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11506", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11506:SF35", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11506:SF35", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01299", "url": "http://pfam.xfam.org/family/PF01299", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9D387", "url": "http://purl.obolibrary.org/obo/PR_Q9D387", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_083806", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083806", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A2AT95", "url": "https://www.uniprot.org/uniprot/A2AT95", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A2AT95-1", "url": "https://www.uniprot.org/uniprot/A2AT95-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D387-1", "url": "https://www.uniprot.org/uniprot/Q9D387-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDLRVRTLLGGDRLRILLMFFHVMVQTVAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQAEISLTRGAEVKGHCGHNESELEVFWVDHAYTLRMLFVKESHNTSKGPEATWNLNKVHFVYDSSEKTHFKAPVKVNKYIASSHHLSALVTPAGMSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEQEQLEETLPLILGLILGLVIVITLVIYHIHHKMTANQVQIPRDRSQYKHMG", "length": 280, "header": "sp|Q9D387-1|LAMP5_MOUSE Isoform 1 of Lysosome-associated membrane glycoprotein 5 OS=Mus musculus OX=10090 GN=Lamp5 PE=1 SV=2 CANONICAL=Q9D387-1" }, "isoforms": [ { "isoform_ac": "A2AT95-1", "url": "", "sequence": { "sequence": "MDLRVRTLLGGDRLRILLMFFHVMVQTVAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQAEISLTR", "length": 91, "header": "tr|A2AT95-1|LAMP5_MOUSE Computationally mapped isoform of Lysosome-associated membrane glycoprotein 5 OS=Mus musculus OX=10090 GN=Lamp5 PE=1 SV=1 CANONICAL=Q9D387-1" }, "locus": { "chromosome": "2", "start_pos": 135901450, "end_pos": 135900233, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000144403.8", "url": "https://www.ensembl.org/id/ENSMUST00000144403.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000120703.2", "url": "https://www.ensembl.org/id/ENSMUSP00000120703.2" } ] } }, { "isoform_ac": "Q9D387-1", "url": "", "sequence": { "sequence": "MDLRVRTLLGGDRLRILLMFFHVMVQTVAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQAEISLTRGAEVKGHCGHNESELEVFWVDHAYTLRMLFVKESHNTSKGPEATWNLNKVHFVYDSSEKTHFKAPVKVNKYIASSHHLSALVTPAGMSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEQEQLEETLPLILGLILGLVIVITLVIYHIHHKMTANQVQIPRDRSQYKHMG", "length": 280, "header": "sp|Q9D387-1|LAMP5_MOUSE Isoform 1 of Lysosome-associated membrane glycoprotein 5 OS=Mus musculus OX=10090 GN=Lamp5 PE=1 SV=2 CANONICAL=Q9D387-1" }, "locus": { "chromosome": "2", "start_pos": 135911108, "end_pos": 135900233, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000057503", "url": "https://www.ensembl.org/id/ENSMUST00000057503" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000061180", "url": "https://www.ensembl.org/id/ENSMUSP00000061180" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 102, "start_aa": "Asn", "end_pos": 102, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn102", "evidence": [ { "id": "Q9D387", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D387#ptm_processing" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 127, "start_aa": "Asn", "end_pos": 127, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn127", "evidence": [ { "id": "2496", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2496" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 127, "start_aa": "Asn", "end_pos": 127, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn127", "evidence": [ { "id": "2496", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2496" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G10773YW", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 127, "start_aa": "Asn", "end_pos": 127, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn127", "evidence": [ { "id": "2496", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2496" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 127, "start_aa": "Asn", "end_pos": 127, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn127", "evidence": [ { "id": "2496", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2496" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 127, "start_aa": "Asn", "end_pos": 127, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn127", "evidence": [ { "id": "2496", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2496" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 127, "start_aa": "Asn", "end_pos": 127, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn127", "evidence": [ { "id": "2496", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2496" }, { "id": "30899004", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 127, "start_aa": "Asn", "end_pos": 127, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn127", "evidence": [ { "id": "Q9D387", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D387#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 35, "start_aa": "Asn", "end_pos": 35, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn35", "evidence": [ { "id": "Q9D387", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D387#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "Q9D387", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D387#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "BAD-LAMP defines a subset of early endocytic organelles in subpopulations of cortical projection neurons.", "journal": "J. Cell Sci.", "date": "2007", "authors": "David A, Tiveron MC, Defays A, Beclin C, Camosseto V, Gatti E, Cremer H, Pierre P", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "reference": [ { "type": "PubMed", "id": "17215451", "url": "https://glygen.org/publication/PubMed/17215451" } ] }, { "title": "LAMP5 fine-tunes GABAergic synaptic transmission in defined circuits of the mouse brain.", "journal": "PLoS ONE", "date": "2016", "authors": "Tiveron MC, Beurrier C, Ceni C, Andriambao N, Combes A, Koehl M, Maurice N, Gatti E, Abrous DN, Kerkerian-Le Goff L, Pierre P, Cremer H", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "reference": [ { "type": "PubMed", "id": "27272053", "url": "https://glygen.org/publication/PubMed/27272053" } ] }, { "title": "Capturing site-specific heterogeneity with large-scale N-glycoproteome analysis.", "journal": "Nature communications", "date": "2019", "authors": "Riley NM, Hebert AS, Westphall MS, Coon JJ", "evidence": [ { "database": "GlyConnect", "id": "2496", "url": "https://glyconnect.expasy.org/browser/proteins/2496" } ], "reference": [ { "type": "PubMed", "id": "30899004", "url": "https://glygen.org/publication/PubMed/30899004" } ] }, { "title": "Loss of LAMP5 interneurons drives neuronal network dysfunction in Alzheimer's disease.", "journal": "Acta neuropathologica", "date": "2022", "authors": "Deng Y, Bi M, Delerue F, Forrest SL, Chan G, van der Hoven J, van Hummel A, Feiten AF, Lee S, Martinez-Valbuena I, Karl T, Kovacs GG, Morahan G, Ke YD, Ittner LM", "evidence": [ { "database": "RefSeq", "id": "NP_083806", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083806" } ], "reference": [ { "type": "PubMed", "id": "35780436", "url": "https://glygen.org/publication/PubMed/35780436" } ] } ], "pathway": [ { "id": "mmu:76161", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:76161", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q5PPI4-1", "protein_name": "Lysosome-associated membrane glycoprotein 5", "gene_name": "Lamp5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDLRGRALLGGDRLRILLMFFHAMAQTVAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQAEISLTRGAEVKGRCGHNESELQVFWVDRAYTLKMLFVKESHNTSKGLEATWKLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGMSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIVITLVIYHIHHKMTANQVQIPRDRSQYKHMG", "length": 280 }, "evidence": [ { "id": "45240182", "url": "http://www.informatics.jax.org/homology/45240182", "database": "MGI" }, { "id": "Q9D387", "url": "https://omabrowser.org/oma/group/Q9D387/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9UJQ1-1", "protein_name": "Lysosome-associated membrane glycoprotein 5", "gene_name": "LAMP5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MDLQGRGVPSIDRLRVLLMLFHTMAQIMAEQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCPVDEREQLEETLPLILGLILGLVIMVTLAIYHVHHKMTANQVQIPRDRSQYKHMG", "length": 280 }, "evidence": [ { "id": "45240182", "url": "http://www.informatics.jax.org/homology/45240182", "database": "MGI" }, { "id": "Q9D387", "url": "https://omabrowser.org/oma/group/Q9D387/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 14, "go_terms": [ { "name": "cellular anatomical entity", "id": "GO:0110165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0110165", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "growth cone membrane", "id": "GO:0032584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032584", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "cytoplasmic vesicle membrane", "id": "GO:0030659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030659", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "early endosome membrane", "id": "GO:0031901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031901", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "recycling endosome membrane", "id": "GO:0055038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055038", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "late endosome", "id": "GO:0005770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005770", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "endoplasmic reticulum-Golgi intermediate compartment membrane", "id": "GO:0033116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033116", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "synaptic vesicle membrane", "id": "GO:0030672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030672", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" }, { "name": "dendrite membrane", "id": "GO:0032590", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032590", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "establishment of protein localization to organelle", "id": "GO:0072594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072594", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 102, "end_pos": 104, "annotation": "n_glycosylation_sequon" }, { "start_pos": 127, "end_pos": 129, "annotation": "n_glycosylation_sequon" }, { "start_pos": 35, "end_pos": 37, "annotation": "n_glycosylation_sequon" }, { "start_pos": 53, "end_pos": 55, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "Q9D387", "url": "https://www.uniprot.org/uniprot/Q9D387" }, { "database": "PubMed", "id": "17215451", "url": "https://glygen.org/publication/PubMed/17215451" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 6 }, { "field": "n_linked_glycan_sites", "count": 5 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 6 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }