{
    "uniprot_canonical_ac": "Q9D1C8-1",
    "uniprot_ac": "Q9D1C8",
    "uniprot_id": "VPS28_MOUSE",
    "mass": {
        "chemical_mass": 25452.0,
        "monoisotopic_mass": 25452.0
    },
    "refseq": {
        "ac": "NP_001292597",
        "name": "vacuolar protein sorting-associated protein 28 homolog isoform 2",
        "summary": "This gene encodes a protein which is thought to be a subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2015].",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292597"
    },
    "gene_names": [
        {
            "name": "Vps28",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9D1C8",
            "id": "Q9D1C8"
        },
        {
            "name": "1110014J03Rik; CIIA; D730005C08Rik",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292597",
            "id": "NP_001292597"
        },
        {
            "name": "Vps28",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292597",
            "id": "NP_001292597"
        }
    ],
    "protein_names": [
        {
            "name": "Vacuolar protein sorting-associated protein 28 homolog",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9D1C8"
        },
        {
            "name": "CIIA",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9D1C8"
        },
        {
            "name": "Caspase-activated DNase inhibitor that interacts with ASK1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9D1C8"
        },
        {
            "name": "ESCRT-I complex subunit VPS28",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9D1C8"
        },
        {
            "name": "vacuolar protein sorting-associated protein 28 homolog isoform 2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292597",
            "id": "NP_001292597"
        },
        {
            "name": "vacuolar protein sorting-associated protein 28 homolog; ESCRT-I complex subunit VPS28; caspase-activated DNase inhibitor that interacts with ASK1",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292597",
            "id": "NP_001292597"
        }
    ],
    "function": [
        {
            "annotation": "CIIA attenuates neurotoxicity caused by OGD/R through inhibiting ASK1-dependent signaling events.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001292597",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292597"
                },
                {
                    "database": "PubMed",
                    "id": "25098452",
                    "url": "https://glygen.org/publication/PubMed/25098452"
                }
            ]
        },
        {
            "annotation": "CIIA functions as a molecular switch for the GEF activity of SOS1, directing this activity toward Rac1.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001292597",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292597"
                },
                {
                    "database": "PubMed",
                    "id": "22042618",
                    "url": "https://glygen.org/publication/PubMed/22042618"
                }
            ]
        },
        {
            "annotation": "Component of the ESCRT-I complex (endosomal sorting complex required for transport I), a regulator of vesicular trafficking process.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "A0A2R8VKS6",
                    "url": "https://www.uniprot.org/uniprot/A0A2R8VKS6#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "PIRNR017535",
                    "url": "https://www.uniprot.org/uniprot/PIRNR017535#function"
                }
            ]
        },
        {
            "annotation": "Component of the ESCRT-I complex, a regulator of vesicular trafficking process.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9D1C8",
                    "url": "https://www.uniprot.org/uniprot/Q9D1C8#function"
                }
            ]
        },
        {
            "annotation": "This gene encodes a protein which is thought to be a subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2015].",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001292597",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292597"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9D1C8",
                    "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Vps28",
            "url": "https://www.uniprot.org/uniprot/Q9D1C8",
            "locus": {
                "chromosome": "15",
                "start_pos": 76506287,
                "end_pos": 76510286,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000115987",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000115987"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000115987",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000115987",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "66914",
            "url": "https://www.ncbi.nlm.nih.gov/gene/66914",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "Q9D1C8",
            "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9D1C8*",
            "database": "IntAct",
            "categories": [
                "Other"
            ]
        },
        {
            "id": "IPR007143",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR007143",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017898",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017898",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR017899",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR017899",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR037202",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR037202",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR037206",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR037206",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR038358",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR038358",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:66914",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66914",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1914164",
            "url": "http://www.informatics.jax.org/marker/MGI:1914164",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "CDEFPTV",
            "url": "https://omabrowser.org/oma/group/CDEFPTV/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5486880at2759",
            "url": "http://www.orthodb.org/?query=5486880at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12937",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12937",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12937:SF0",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12937:SF0",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF03997",
            "url": "http://pfam.xfam.org/family/PF03997",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q9D1C8",
            "url": "http://purl.obolibrary.org/obo/PR_Q9D1C8",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-MMU-917729",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-917729",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_001292597",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292597",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A2R8VKS6",
            "url": "https://www.uniprot.org/uniprot/A0A2R8VKS6",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "A0A2R8VKS6-1",
            "url": "https://www.uniprot.org/uniprot/A0A2R8VKS6-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9D1C8",
            "url": "https://www.uniprot.org/uniprot/Q9D1C8",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9D1C8-1",
            "url": "https://www.uniprot.org/uniprot/Q9D1C8-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MFHGIPATPGVGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA",
        "length": 221,
        "header": "sp|Q9D1C8-1|VPS28_MOUSE Isoform 1 of Vacuolar protein sorting-associated protein 28 homolog  OS=Mus musculus OX=10090 GN=Vps28 PE=1 SV=1 CANONICAL=Q9D1C8-1"
    },
    "isoforms": [
        {
            "isoform_ac": "A0A2R8VKS6-1",
            "url": "",
            "sequence": {
                "sequence": "MAELFAVVKTMQALEKAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA",
                "length": 183,
                "header": "tr|A0A2R8VKS6-1|A0A2R8VKS6_MOUSE Computationally mapped isoform of Vacuolar protein sorting-associated protein 28 homolog  OS=Mus musculus OX=10090 GN=Vps28 PE=1 SV=1 CANONICAL=Q9D1C8-1"
            },
            "locus": {
                "chromosome": "15",
                "start_pos": 76508365,
                "end_pos": 76506436,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000229019.2",
                        "url": "https://www.ensembl.org/id/ENSMUST00000229019.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000155847.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000155847.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9D1C8-1",
            "url": "",
            "sequence": {
                "sequence": "MFHGIPATPGVGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA",
                "length": 221,
                "header": "sp|Q9D1C8-1|VPS28_MOUSE Isoform 1 of Vacuolar protein sorting-associated protein 28 homolog  OS=Mus musculus OX=10090 GN=Vps28 PE=1 SV=1 CANONICAL=Q9D1C8-1"
            },
            "locus": {
                "chromosome": "15",
                "start_pos": 76509370,
                "end_pos": 76506436,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000078803",
                        "url": "https://www.ensembl.org/id/ENSMUST00000078803"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000077856",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000077856"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Identification of a novel antiapoptotic protein that antagonizes ASK1 and CAD activities.",
            "journal": "J. Cell Biol.",
            "date": "2003",
            "authors": "Kim J.W., Cho J.H., Choi E.J., Ichijo H., Kim M.J., Park H.S., Kim M.S., Kang S.S., Lee Y.H., Kim E.K., Cho S.-G., Lee M.J., Hwang H.S., Yoon K.W., Chi S.W., Cho E.G., Noh K.T., Ryoo K.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9D1C8",
                    "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "14557248",
                    "url": "https://glygen.org/publication/PubMed/14557248"
                }
            ]
        },
        {
            "title": "CIIA functions as a molecular switch for the Rac1-specific GEF activity of SOS1.",
            "journal": "The Journal of cell biology",
            "date": "2011",
            "authors": "Hwang HS, Hwang SG, Cho JH, Chae JS, Yoon KW, Cho SG, Choi EJ",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001292597",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292597"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "22042618",
                    "url": "https://glygen.org/publication/PubMed/22042618"
                }
            ]
        },
        {
            "title": "CIIA negatively regulates neuronal cell death induced by oxygen-glucose deprivation and reoxygenation.",
            "journal": "Molecular and cellular biochemistry",
            "date": "2014",
            "authors": "Hwang SG, Shim J, Choi EJ",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_001292597",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001292597"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "25098452",
                    "url": "https://glygen.org/publication/PubMed/25098452"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:66914",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66914",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-MMU-917729",
            "name": "Endosomal Sorting Complex Required For Transport (ESCRT)",
            "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-917729",
            "resource": "Reactome",
            "description": "Endosomal Sorting Complex Required For Transport (ESCRT)"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "B5DEN9-1",
            "protein_name": "Vacuolar protein sorting-associated protein 28 homolog",
            "gene_name": "Vps28",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MFHGIPATPGVGALPCSVAAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHS",
                "length": 228
            },
            "evidence": [
                {
                    "id": "45236320",
                    "url": "http://www.informatics.jax.org/homology/45236320",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q02767-1",
            "protein_name": "Vacuolar protein sorting-associated protein 28",
            "gene_name": "VPS28",
            "tax_id": 559292,
            "organism": "Saccharomyces cerevisiae S288C",
            "sequence": {
                "sequence": "MQKHNIKLNQNQDISQLFHDEVPLFDNSITSKDKEVIETLSEIYSIVITLDHVEKAYLKDSIDDTQYTNTVDKLLKQFKVYLNSQNKEEINKHFQSIEAFCDTYNITASNAITRLERGIPITAEHAISTTTSAPSGDNKQSSSSDKKFNAKYVAEATGNFITVMDALKLNYNAKDQLHPLLAELLISINRVTRDDFENRSKLIDWIVRINKLSIGDTLTETQIRELLFDLELAYKSFYALLD",
                "length": 242
            },
            "evidence": [
                {
                    "id": "Q9D1C8",
                    "url": "https://omabrowser.org/oma/group/Q9D1C8/",
                    "database": "OMA"
                }
            ],
            "common_name": "Yeast"
        },
        {
            "uniprot_canonical_ac": "Q9UK41-1",
            "protein_name": "Vacuolar protein sorting-associated protein 28 homolog",
            "gene_name": "VPS28",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA",
                "length": 221
            },
            "evidence": [
                {
                    "id": "45236320",
                    "url": "http://www.informatics.jax.org/homology/45236320",
                    "database": "MGI"
                },
                {
                    "id": "Q9D1C8",
                    "url": "https://omabrowser.org/oma/group/Q9D1C8/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        },
        {
            "uniprot_canonical_ac": "Q9V359-1",
            "protein_name": "Vacuolar protein sorting-associated protein 28 homolog",
            "gene_name": "Vps28",
            "tax_id": 7227,
            "organism": "Drosophila melanogaster",
            "sequence": {
                "sequence": "MQEQSPELYEEVKLFRNAREREKYDNMADLYAIINTIQQLEKAYIRDCITPQEYTAACSKYLVQYKVAFKQVQCDEFPSVETFVKKFRLDCPAALERIREDRPITIRDDKGNTSKCIAEIVSLFITIMDKLRLQINTMDALQPDVKDLADNMNRLSLIPEDFDAKLKVEKWLGSLNEMQASDELSEGQVRQFLFDLESAYADFNKLLHSQ",
                "length": 210
            },
            "evidence": [
                {
                    "id": "Q9D1C8",
                    "url": "https://omabrowser.org/oma/group/Q9D1C8/",
                    "database": "OMA"
                }
            ],
            "common_name": "Fruit fly"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 5,
                "go_terms": [
                    {
                        "name": "protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway",
                        "id": "GO:0043328",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043328",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of ubiquitin-dependent endocytosis",
                        "id": "GO:2000397",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000397",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of protein catabolic process",
                        "id": "GO:0045732",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045732",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "negative regulation of protein ubiquitination",
                        "id": "GO:0031397",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031397",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway",
                        "id": "GO:0043162",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043162",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 8,
                "go_terms": [
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "endosome",
                        "id": "GO:0005768",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005768",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "early endosome",
                        "id": "GO:0005769",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytosol",
                        "id": "GO:0005829",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "plasma membrane",
                        "id": "GO:0005886",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "late endosome membrane",
                        "id": "GO:0031902",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "endosome membrane",
                        "id": "GO:0010008",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ESCRT I complex",
                        "id": "GO:0000813",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000813",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 2,
                "go_terms": [
                    {
                        "name": "protein-containing complex binding",
                        "id": "GO:0044877",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "ubiquitin binding",
                        "id": "GO:0043130",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043130",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9D1C8",
                                "url": "https://www.uniprot.org/uniprot/Q9D1C8"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 3
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}