{ "uniprot_canonical_ac": "Q9D084-1", "uniprot_ac": "Q9D084", "uniprot_id": "CENPS_MOUSE", "mass": { "chemical_mass": 16335.0, "monoisotopic_mass": 16335.0 }, "refseq": { "ac": "NP_081539", "name": "centromere protein S", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081539" }, "gene_names": [ { "name": "Cenps", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9D084", "id": "Q9D084" }, { "name": "2610040C18Rik; 2810407L01Rik; Apitd1; CENP-S", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081539", "id": "NP_081539" }, { "name": "Apitd1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9D084", "id": "Q9D084" }, { "name": "Cenps", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081539", "id": "NP_081539" }, { "name": "FAAP16", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9D084", "id": "Q9D084" }, { "name": "MHF1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9D084", "id": "Q9D084" } ], "protein_names": [ { "name": "Centromere protein S", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9D084" }, { "name": "Apoptosis-inducing TAF9-like domain-containing protein 1 homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D084" }, { "name": "CENP-S", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D084" }, { "name": "FANCM-interacting histone fold protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D084" }, { "name": "centromere protein S", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081539", "id": "NP_081539" }, { "name": "ortholog of human apoptosis-inducing, TAF9-like domain 1 APITD1; apoptosis-inducing TAF9-like domain-containing protein 1 homolog; FANCM-interacting histone fold protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081539", "id": "NP_081539" } ], "function": [ { "annotation": "DNA-binding component of the Fanconi anemia (FA) core complex. Required for the normal activation of the FA pathway, leading to monoubiquitination of the FANCI-FANCD2 complex in response to DNA damage, cellular resistance to DNA cross-linking drugs, and prevention of chromosomal breakage. In complex with CENPX (MHF heterodimer), crucial cofactor for FANCM in both binding and ATP-dependent remodeling of DNA. Stabilizes FANCM. In complex with CENPX and FANCM (but not other FANC proteins), rapidly recruited to blocked forks and promotes gene conversion at blocked replication forks. In complex with CENPT, CENPW and CENPX (CENP-T-W-S-X heterotetramer), involved in the formation of a functional kinetochore outer plate, which is essential for kinetochore-microtubule attachment and faithful mitotic progression. As a component of MHF and CENP-T-W-S-X complexes, binds DNA and bends it to form a nucleosome-like structure. DNA-binding function is fulfilled in the presence of CENPX, with the following preference for DNA substates: Holliday junction > double-stranded > splay arm > single-stranded. Does not bind DNA on its own.", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084#function" }, { "database": "UniProtKB", "id": "Q8N2Z9", "url": "https://www.uniprot.org/uniprot/Q8N2Z9#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Cenps", "url": "https://www.uniprot.org/uniprot/Q9D084", "locus": { "chromosome": "4", "start_pos": 149211578, "end_pos": 149222086, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000073705", "url": "https://www.ensembl.org/id/ENSMUSG00000073705" } ] } } ], "crossref": [ { "id": "ENSMUSG00000073705", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000073705", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "69928", "url": "https://www.ncbi.nlm.nih.gov/gene/69928", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR009072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029003", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029003", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:69928", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69928", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1917178", "url": "http://www.informatics.jax.org/marker/MGI:1917178", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "WTQIENV", "url": "https://omabrowser.org/oma/group/WTQIENV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5395965at2759", "url": "http://www.orthodb.org/?query=5395965at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22980", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22980", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22980:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22980:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15630", "url": "http://pfam.xfam.org/family/PF15630", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9D084", "url": "http://purl.obolibrary.org/obo/PR_Q9D084", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-141430", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-141430", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-141444", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-141444", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2467813", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2500257", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5663220", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-606279", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-6783310", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6783310", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-68877", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-68877", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9648025", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-9833482", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9833482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_081539", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_081539", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A140T8U2", "url": "https://www.uniprot.org/uniprot/A0A140T8U2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140T8U2-1", "url": "https://www.uniprot.org/uniprot/A0A140T8U2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6PWQ1", "url": "https://www.uniprot.org/uniprot/A6PWQ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6PWQ1-1", "url": "https://www.uniprot.org/uniprot/A6PWQ1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6PWQ2", "url": "https://www.uniprot.org/uniprot/A6PWQ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A6PWQ2-1", "url": "https://www.uniprot.org/uniprot/A6PWQ2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BKU9", "url": "https://www.uniprot.org/uniprot/H3BKU9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BKU9-1", "url": "https://www.uniprot.org/uniprot/H3BKU9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D084-1", "url": "https://www.uniprot.org/uniprot/Q9D084-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D084-2", "url": "https://www.uniprot.org/uniprot/Q9D084-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEEVEAEEPQEFSHRQRLKAAVHYTVGCLCQEVTLNKQVNFSKQTIAAISEVTFRQCENFAKDLEMFARHAKRSTVTTEDVKLLARRNNSLLKYITEKNEEIAQLNLKGKAKKKRKPEDESRSSRESMAEELDGAEELQSES", "length": 142, "header": "sp|Q9D084-1|CENPS_MOUSE Isoform 1 of Centromere protein S OS=Mus musculus OX=10090 GN=Cenps PE=2 SV=1 CANONICAL=Q9D084-1" }, "isoforms": [ { "isoform_ac": "A0A140T8U2-1", "url": "", "sequence": { "sequence": "MFARHAKRSTVTTEDVKLLARRNNSLLKYITEKNEEIAQLNLKGKAKKKRKPEDESRSSRESMAEELDGAEELQSES", "length": 77, "header": "tr|A0A140T8U2-1|CENPS_MOUSE Computationally mapped isoform of Centromere protein S OS=Mus musculus OX=10090 GN=Cenps PE=2 SV=1 CANONICAL=Q9D084-1" }, "locus": { "chromosome": "4", "start_pos": 149216106, "end_pos": 149213233, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000176124.8", "url": "https://www.ensembl.org/id/ENSMUST00000176124.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000134756.3", "url": "https://www.ensembl.org/id/ENSMUSP00000134756.3" } ] } }, { "isoform_ac": "A6PWQ1-1", "url": "", "sequence": { "sequence": "MFARHAKRSTVTTEDVKLLARRNNSLLKYITEKNEEIAQLNLKGKAKKKRKPEDESRS", "length": 58, "header": "tr|A6PWQ1-1|CENPS_MOUSE Computationally mapped isoform of Centromere protein S OS=Mus musculus OX=10090 GN=Cenps PE=2 SV=1 CANONICAL=Q9D084-1" }, "locus": { "chromosome": "4", "start_pos": 149216106, "end_pos": 149213290, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000150150.3", "url": "https://www.ensembl.org/id/ENSMUST00000150150.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000121878.3", "url": "https://www.ensembl.org/id/ENSMUSP00000121878.3" } ] } }, { "isoform_ac": "A6PWQ2-1", "url": "", "sequence": { "sequence": "MEEVEAEEPQEFSHRQRLKAAVHYTVGCLCQEVTLNKQVNFSKQTIAAISEVTFRQCENFAKDLEMFARNVQTADLGILESPRPGTLQVCMSLRGPGQRPWH", "length": 102, "header": "tr|A6PWQ2-1|CENPS_MOUSE Computationally mapped isoform of Centromere protein S OS=Mus musculus OX=10090 GN=Cenps PE=2 SV=1 CANONICAL=Q9D084-1" }, "locus": { "chromosome": "4", "start_pos": 149221980, "end_pos": 149211795, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105696.8", "url": "https://www.ensembl.org/id/ENSMUST00000105696.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101321.2", "url": "https://www.ensembl.org/id/ENSMUSP00000101321.2" } ] } }, { "isoform_ac": "H3BKU9-1", "url": "", "sequence": { "sequence": "MEEVEAEEPQEFSHRQRLKAAVHYTVGCLCQEVTLNKQVNFSKQTIAAISEKILPKTLKCLPDTRKEARSPLKT", "length": 74, "header": "tr|H3BKU9-1|CENPS_MOUSE Computationally mapped isoform of Centromere protein S OS=Mus musculus OX=10090 GN=Cenps PE=2 SV=1 CANONICAL=Q9D084-1" }, "locus": { "chromosome": "4", "start_pos": 149221980, "end_pos": 149214642, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000177408.2", "url": "https://www.ensembl.org/id/ENSMUST00000177408.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000135536.2", "url": "https://www.ensembl.org/id/ENSMUSP00000135536.2" } ] } }, { "isoform_ac": "Q9D084-1", "url": "", "sequence": { "sequence": "MEEVEAEEPQEFSHRQRLKAAVHYTVGCLCQEVTLNKQVNFSKQTIAAISEVTFRQCENFAKDLEMFARHAKRSTVTTEDVKLLARRNNSLLKYITEKNEEIAQLNLKGKAKKKRKPEDESRSSRESMAEELDGAEELQSES", "length": 142, "header": "sp|Q9D084-1|CENPS_MOUSE Isoform 1 of Centromere protein S OS=Mus musculus OX=10090 GN=Cenps PE=2 SV=1 CANONICAL=Q9D084-1" }, "locus": { "chromosome": "4", "start_pos": 149221980, "end_pos": 149213233, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000030813", "url": "https://www.ensembl.org/id/ENSMUST00000030813" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000030813", "url": "https://www.ensembl.org/id/ENSMUSP00000030813" } ] } }, { "isoform_ac": "Q9D084-2", "url": "", "sequence": { "sequence": "MEEVEAEEPQEFSHRQRLKAAVHYTVGCLCQEVTLNKQVNFSKQTIAAISEVTFRQCENFAKDLEMFARWVEKLAV", "length": 76, "header": "sp|Q9D084-2|CENPS_MOUSE Isoform 2 of Centromere protein S OS=Mus musculus OX=10090 GN=Cenps PE=2 SV=1 CANONICAL=Q9D084-1" }, "locus": { "chromosome": "4", "start_pos": 149221980, "end_pos": 149216074, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000105695", "url": "https://www.ensembl.org/id/ENSMUST00000105695" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000101320", "url": "https://www.ensembl.org/id/ENSMUSP00000101320" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:69928", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:69928", "resource": "KEGG Pathway" }, { "id": "R-MMU-141430", "name": "Inactivation of APC/C via direct inhibition of the APC/C complex", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-141430", "resource": "Reactome", "description": "Inactivation of APC/C via direct inhibition of the APC/C complex" }, { "id": "R-MMU-141444", "name": "Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-141444", "resource": "Reactome", "description": "Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal" }, { "id": "R-MMU-2467813", "name": "Separation of Sister Chromatids", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2467813", "resource": "Reactome", "description": "Separation of Sister Chromatids" }, { "id": "R-MMU-2500257", "name": "Resolution of Sister Chromatid Cohesion", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-2500257", "resource": "Reactome", "description": "Resolution of Sister Chromatid Cohesion" }, { "id": "R-MMU-5663220", "name": "RHO GTPases Activate Formins", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5663220", "resource": "Reactome", "description": "RHO GTPases Activate Formins" }, { "id": "R-MMU-606279", "name": "Deposition of new CENPA-containing nucleosomes at the centromere", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-606279", "resource": "Reactome", "description": "Deposition of new CENPA-containing nucleosomes at the centromere" }, { "id": "R-MMU-6783310", "name": "Fanconi Anemia Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6783310", "resource": "Reactome", "description": "Fanconi Anemia Pathway" }, { "id": "R-MMU-68877", "name": "Mitotic Prometaphase", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-68877", "resource": "Reactome", "description": "Mitotic Prometaphase" }, { "id": "R-MMU-9648025", "name": "EML4 and NUDC in mitotic spindle formation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9648025", "resource": "Reactome", "description": "EML4 and NUDC in mitotic spindle formation" }, { "id": "R-MMU-9833482", "name": "PKR-mediated signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-9833482", "resource": "Reactome", "description": "PKR-mediated signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8N2Z9-1", "protein_name": "Centromere protein S", "gene_name": "CENPS", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEEEAETEEQQRFSYQQRLKAAVHYTVGCLCEEVALDKEMQFSKQTIAAISELTFRQCENFAKDLEMFARHAKRTTINTEDVKLLARRSNSLLKYITDKSEEIAQINLERKAQKKKKSEDGSKNSRQPAEAGVVESEN", "length": 138 }, "evidence": [ { "id": "45240011", "url": "http://www.informatics.jax.org/homology/45240011", "database": "MGI" }, { "id": "Q9D084", "url": "https://omabrowser.org/oma/group/Q9D084/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "FANCM-MHF complex", "id": "GO:0071821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071821", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" }, { "name": "Fanconi anaemia nuclear complex", "id": "GO:0043240", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043240", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" }, { "name": "kinetochore", "id": "GO:0000776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000776", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "DNA repair", "id": "GO:0006281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006281", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" }, { "name": "resolution of meiotic recombination intermediates", "id": "GO:0000712", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000712", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" }, { "name": "DNA damage response", "id": "GO:0006974", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006974", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" }, { "name": "interstrand cross-link repair", "id": "GO:0036297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036297", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" }, { "name": "replication fork processing", "id": "GO:0031297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031297", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" }, { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" }, { "name": "double-stranded DNA binding", "id": "GO:0003690", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003690", "evidence": [ { "database": "UniProtKB", "id": "Q9D084", "url": "https://www.uniprot.org/uniprot/Q9D084" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" }, { "start_pos": 88, "end_pos": 90, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }