{ "uniprot_canonical_ac": "Q9D009-1", "uniprot_ac": "Q9D009", "uniprot_id": "LIPT2_MOUSE", "mass": { "chemical_mass": 24955.0, "monoisotopic_mass": 24955.0 }, "refseq": { "ac": "NP_080286", "name": "putative lipoyltransferase 2, mitochondrial", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080286" }, "gene_names": [ { "name": "Lipt2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9D009", "id": "Q9D009" }, { "name": "2610209A20Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080286", "id": "NP_080286" }, { "name": "Lipt2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080286", "id": "NP_080286" } ], "protein_names": [ { "name": "Putative lipoyltransferase 2, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9D009" }, { "name": "2.3.1.181", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D009" }, { "name": "Lipoate-protein ligase B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D009" }, { "name": "Lipoyl/octanoyl transferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D009" }, { "name": "Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9D009" }, { "name": "putative lipoyltransferase 2, mitochondrial", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080286", "id": "NP_080286" }, { "name": "putative octanoyltransferase, mitochondrial; lipoate-protein ligase B; lipoyl/octanoyl transferase; octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080286", "id": "NP_080286" } ], "function": [ { "annotation": "Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes, which catalyze essential redox reactions (By similarity). Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9D009", "url": "https://www.uniprot.org/uniprot/Q9D009#function" }, { "database": "UniProtKB", "id": "A6NK58", "url": "https://www.uniprot.org/uniprot/A6NK58#function" } ] } ], "disease": [ { "disease_id": "DOID:9268", "recommended_name": { "id": "DOID:9268", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9268", "name": "glycine encephalopathy", "description": "An amino acid metabolic disorder that involves abnormally high levels of the amino acid glycine in bodily fluids and tissues." }, "synonyms": [ { "id": "DOID:9268", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9268", "name": "Non-ketotic hyperglycinemia", "description": "" }, { "id": "DOID:9268", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9268", "name": "nonketotic hyperglycinemia", "description": "" }, { "id": "MONDO:0011612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011612", "name": "glycine encephalopathy", "description": "Glycine encephalopathy (GE) is an inborn error of glycine metabolism characterized by accumulation of glycine in body fluids and tissues, including the brain, resulting in neurometabolic symptoms of variable severity." }, { "id": "MONDO:0011612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011612", "name": "NKA", "description": "" }, { "id": "MONDO:0011612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011612", "name": "glycine encephalopathy", "description": "" }, { "id": "MONDO:0011612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011612", "name": "non-ketotic hyperglycinemia", "description": "" }, { "id": "MONDO:0011612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011612", "name": "nonketotic hyperglycinemia", "description": "" }, { "id": "MONDO:0011612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011612", "name": "GCE", "description": "" }, { "id": "MONDO:0011612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011612", "name": "GLYCINE encephalopathy", "description": "" }, { "id": "MONDO:0011612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011612", "name": "Glycine synthase deficiency", "description": "" }, { "id": "MONDO:0011612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011612", "name": "hyperglycinemia nonketotic", "description": "" }, { "id": "MONDO:0011612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011612", "name": "hyperglycinemia, Nonketotic", "description": "" }, { "id": "MONDO:0011612", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011612", "name": "hyperglycinemia, transient neonatal", "description": "" }, { "id": "MIM:605899", "resource": "MIM", "url": "https://www.omim.org/entry/605899", "name": "Non-ketotic hyperglycinemia", "description": "Non-ketotic hyperglycinemia" } ], "evidence": [ { "id": "9268", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:9268" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9D009", "url": "https://www.uniprot.org/uniprot/Q9D009" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Lipt2", "url": "https://www.uniprot.org/uniprot/Q9D009", "locus": { "chromosome": "7", "start_pos": 99810572, "end_pos": 99808484, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000030725", "url": "https://www.ensembl.org/id/ENSMUSG00000030725" } ] } } ], "crossref": [ { "id": "ENSMUSG00000030725", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000030725", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.3.1.181", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.3.1.181&UniProtAcc=Q9D009", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd16444", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16444", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "67164", "url": "https://www.ncbi.nlm.nih.gov/gene/67164", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000544", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000544", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004143", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004143", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045864", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045864", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:67164", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67164", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1914414", "url": "http://www.informatics.jax.org/marker/MGI:1914414", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "GEVTYHC", "url": "https://omabrowser.org/oma/group/GEVTYHC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "166876at2759", "url": "http://www.orthodb.org/?query=166876at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10993", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10993", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10993:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10993:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9D009", "url": "http://purl.obolibrary.org/obo/PR_Q9D009", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-389661", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_080286", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080286", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "17665", "url": "https://www.rhea-db.org/rhea/17665", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A140LJ31", "url": "https://www.uniprot.org/uniprot/A0A140LJ31", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LJ31-1", "url": "https://www.uniprot.org/uniprot/A0A140LJ31-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D009", "url": "https://www.uniprot.org/uniprot/Q9D009", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D009-1", "url": "https://www.uniprot.org/uniprot/Q9D009-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSLPVVRLVWLGRVHYSELLALQEHWLRRLQADPRPGTLSGTKAGVLLVCEPAGPVYTGGLRGGLTPEETTRLRALGAEVRATGRGGLATFHGPGQLLCHPVLDLRLLGLRLRTHVAALEACAVRLCELRGLQGARARPPPYTGVWLGERKICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSEALQRLVTVDEVMPSFLVAFKETFKCTLISEDSPS", "length": 231, "header": "sp|Q9D009-1|LIPT2_MOUSE Isoform 1 of Putative lipoyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Lipt2 PE=1 SV=2 CANONICAL=Q9D009-1" }, "isoforms": [ { "isoform_ac": "A0A140LJ31-1", "url": "", "sequence": { "sequence": "XLRRLQADPRPGTLSGTKAGVLLVCEPAGPVYTGGLRGGLTPEETTRLRALGAEESAVEDTSRPTAWL", "length": 68, "header": "tr|A0A140LJ31-1|A0A140LJ31_MOUSE Computationally mapped isoform of Lipoyl(octanoyl) transferase 2 (putative) OS=Mus musculus OX=10090 GN=Lipt2 PE=1 SV=1 CANONICAL=Q9D009-1" }, "locus": { "chromosome": "7", "start_pos": 99809424, "end_pos": 99808566, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000207825.2", "url": "https://www.ensembl.org/id/ENSMUST00000207825.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000147056.2", "url": "https://www.ensembl.org/id/ENSMUSP00000147056.2" } ] } }, { "isoform_ac": "Q9D009-1", "url": "", "sequence": { "sequence": "MSLPVVRLVWLGRVHYSELLALQEHWLRRLQADPRPGTLSGTKAGVLLVCEPAGPVYTGGLRGGLTPEETTRLRALGAEVRATGRGGLATFHGPGQLLCHPVLDLRLLGLRLRTHVAALEACAVRLCELRGLQGARARPPPYTGVWLGERKICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSEALQRLVTVDEVMPSFLVAFKETFKCTLISEDSPS", "length": 231, "header": "sp|Q9D009-1|LIPT2_MOUSE Isoform 1 of Putative lipoyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Lipt2 PE=1 SV=2 CANONICAL=Q9D009-1" }, "locus": { "chromosome": "7", "start_pos": 99809607, "end_pos": 99808489, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000032967", "url": "https://www.ensembl.org/id/ENSMUST00000032967" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000032967", "url": "https://www.ensembl.org/id/ENSMUSP00000032967" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "A0A140LJ31", "url": "https://www.uniprot.org/uniprot/A0A140LJ31" }, { "database": "UniProtKB", "id": "Q9D009", "url": "https://www.uniprot.org/uniprot/Q9D009" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] } ], "pathway": [ { "id": "mmu:67164", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67164", "resource": "KEGG Pathway" }, { "id": "R-MMU-389661", "name": "Glyoxylate metabolism and glycine degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-389661", "resource": "Reactome", "description": "Glyoxylate metabolism and glycine degradation" } ], "orthologs": [ { "uniprot_canonical_ac": "A6NK58-1", "protein_name": "Putative lipoyltransferase 2, mitochondrial", "gene_name": "LIPT2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQAEPGIEAPSGTEAGALLLCEPAGPVYTAGLRGGLTPEETARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVASLEACAVRLCELQGLQDARARPPPYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCTLISEDSPN", "length": 231 }, "evidence": [ { "id": "45238349", "url": "http://www.informatics.jax.org/homology/45238349", "database": "MGI" }, { "id": "Q9D009", "url": "https://omabrowser.org/oma/group/Q9D009/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "D3Z9Z2-1", "protein_name": "Putative lipoyltransferase 2, mitochondrial", "gene_name": "Lipt2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSLPAVRLLWLGRVHYSELLELQEHWLRQLQADPRPRTLSGTKAGVLLVCEPAGPVYTGGLRGGLTPEETMRLRALGAEVRATGRGGLATFHGPGQLLCHPVLDLRLLGLRLRTHVAALEACAVRLCELRGLRGARARPPPYTGVWLGERKICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSEALQRLVTVDEVMPSFLVAFKETFKCTLISEDRPS", "length": 231 }, "evidence": [ { "id": "45238349", "url": "http://www.informatics.jax.org/homology/45238349", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9VN27-1", "protein_name": "Putative lipoyltransferase 2, mitochondrial", "gene_name": "Lipt2", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MPFVRPLVTVVRAGRHSYSAGLQLQQRLARSNQILNPPAEFRNYLVLQEHDPVYTVGLRTKDYTAQDEDRLRRLGADFHRTDRGGLITFHGPGQLVAYPILHLGQFVPSIRWYVATLERMVVEACHQMGISSAKATKDTGIWVGDNKICAIGIHGSRYVTTHGIGLNCCTDLQWFEHIVPCGIEGKGVTSLSKELDRHFPVEEASGALLNSFAKVFECRLQEHAKKPASSAEIG", "length": 234 }, "evidence": [ { "id": "Q9D009", "url": "https://omabrowser.org/oma/group/Q9D009/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "positive regulation of oxygen metabolic process", "id": "GO:2000376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000376", "evidence": [ { "database": "UniProtKB", "id": "Q9D009", "url": "https://www.uniprot.org/uniprot/Q9D009" } ], "pmid": "" }, { "name": "protein lipoylation", "id": "GO:0009249", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009249", "evidence": [ { "database": "UniProtKB", "id": "Q9D009", "url": "https://www.uniprot.org/uniprot/Q9D009" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q9D009", "url": "https://www.uniprot.org/uniprot/Q9D009" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "ligase activity", "id": "GO:0016874", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016874", "evidence": [ { "database": "UniProtKB", "id": "Q9D009", "url": "https://www.uniprot.org/uniprot/Q9D009" } ], "pmid": "" }, { "name": "lipoyl(octanoyl) transferase activity", "id": "GO:0033819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033819", "evidence": [ { "database": "UniProtKB", "id": "Q9D009", "url": "https://www.uniprot.org/uniprot/Q9D009" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 171, "end_pos": 173, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "17665", "name": "", "equation": "L-lysyl-[protein] + octanoyl-[ACP] = H(+) + holo-[ACP] + N(6)-octanoyl-L-lysyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D3Z9Z2-1", "A6NK58-1", "Q9D009-1", "Q06005-1", "Q9VN27-1" ], "evidence": [ { "id": "17665", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17665" } ] }, { "id": "R-MMU-6793590", "name": "LIPT2 transfers octanoyl group to GCSH", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "mitochondrial inner membrane, mitochondrial matrix", "input_participant_list": [ "R-MMU-5693951" ], "output_participant_list": [ "R-MMU-163925", "R-MMU-6793586" ], "enzyme_list": [ "Q9D009-1" ], "evidence": [ { "id": "R-MMU-6793590", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6793590" } ] } ], "reaction_participants": [ { "participant_id": "R-MMU-163925", "participant_name": "Ndufab1 [mitochondrial inner membrane]", "crossref": [ { "id": "Q9CR21", "database": "UniProt", "url": "" }, { "id": "6ZTQ", "database": "PDB", "url": "" }, { "id": "7PSA", "database": "PDB", "url": "" }, { "id": "Q9CR21", "database": "PRO", "url": "" }, { "id": "6ZR2", "database": "PDB", "url": "" }, { "id": "7B93", "database": "PDB", "url": "" }, { "id": "6G72", "database": "PDB", "url": "" }, { "id": "ENSMUST00000033157", "database": "Ensembl", "url": "" }, { "id": "7AK6", "database": "PDB", "url": "" }, { "id": "ENSMUSG00000030869", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000123296", "database": "Ensembl", "url": "" }, { "id": "ENSMUSP00000116177", "database": "Ensembl", "url": "" }, { "id": "6G2J", "database": "PDB", "url": "" }, { "id": "XP_006508263.1", "database": "RefSeq", "url": "" }, { "id": "NP_082453.2", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000033157", "database": "Ensembl", "url": "" }, { "id": "1917566", "database": "MGI", "url": "" }, { "id": "7AK5", "database": "PDB", "url": "" } ] }, { "participant_id": "R-MMU-5693951", "participant_name": "Gcsh [mitochondrial matrix]", "crossref": [ { "id": "ENSMUST00000040484", "database": "Ensembl", "url": "" }, { "id": "2EDG", "database": "PDB", "url": "" }, { "id": "NP_080848.1", "database": "RefSeq", "url": "" }, { "id": "Q91WK5", "database": "PRO", "url": "" }, { "id": "1915383", "database": "MGI", "url": "" }, { "id": "ENSMUSG00000034424", "database": "Ensembl", "url": "" }, { "id": "Q91WK5", "database": "UniProt", "url": "" }, { "id": "ENSMUSP00000037131", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-MMU-6793586", "participant_name": "Gcsh [mitochondrial matrix]", "crossref": [ { "id": "Q91WK5", "database": "UniProt", "url": "" }, { "id": "2EDG", "database": "PDB", "url": "" }, { "id": "1915383", "database": "MGI", "url": "" }, { "id": "NP_080848.1", "database": "RefSeq", "url": "" }, { "id": "ENSMUSP00000037131", "database": "Ensembl", "url": "" }, { "id": "ENSMUST00000040484", "database": "Ensembl", "url": "" }, { "id": "ENSMUSG00000034424", "database": "Ensembl", "url": "" }, { "id": "Q91WK5", "database": "PRO", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A6NK58", "gene_name": "LIPT2", "activity": [ { "ec_number": "2.3.1.181", "activity": "L-lysyl-[protein] + octanoyl-[ACP] = H(+) + holo-[ACP] + N(6)-octanoyl-L-lysyl-[protein].", "evidence": [ { "id": "A6NK58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NK58" } ] }, { "ec_number": "2.3.1.181", "activity": "", "evidence": [ { "id": "A6NK58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A6NK58" } ] } ] }, { "uniprot_ac": "D3Z9Z2", "gene_name": "Lipt2", "activity": [ { "ec_number": "2.3.1.181", "activity": "L-lysyl-[protein] + octanoyl-[ACP] = H(+) + holo-[ACP] + N(6)-octanoyl-L-lysyl-[protein].", "evidence": [ { "id": "D3Z9Z2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z9Z2" } ] }, { "ec_number": "2.3.1.181", "activity": "", "evidence": [ { "id": "D3Z9Z2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z9Z2" } ] } ] }, { "uniprot_ac": "Q06005", "gene_name": "LIP2", "activity": [ { "ec_number": "2.3.1.181", "activity": "L-lysyl-[protein] + octanoyl-[ACP] = H(+) + holo-[ACP] + N(6)-octanoyl-L-lysyl-[protein].", "evidence": [ { "id": "Q06005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06005" } ] }, { "ec_number": "2.3.1.181", "activity": "", "evidence": [ { "id": "Q06005", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06005" } ] } ] }, { "uniprot_ac": "Q9D009", "gene_name": "Lipt2", "activity": [ { "ec_number": "2.3.1.181", "activity": "L-lysyl-[protein] + octanoyl-[ACP] = H(+) + holo-[ACP] + N(6)-octanoyl-L-lysyl-[protein].", "evidence": [ { "id": "Q9D009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D009" } ] }, { "ec_number": "2.3.1.181", "activity": "", "evidence": [ { "id": "Q9D009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D009" } ] } ] }, { "uniprot_ac": "Q9VN27", "gene_name": "Lipt2", "activity": [ { "ec_number": "2.3.1.181", "activity": "L-lysyl-[protein] + octanoyl-[ACP] = H(+) + holo-[ACP] + N(6)-octanoyl-L-lysyl-[protein].", "evidence": [ { "id": "Q9VN27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VN27" } ] }, { "ec_number": "2.3.1.181", "activity": "", "evidence": [ { "id": "Q9VN27", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VN27" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }