{ "uniprot_canonical_ac": "Q9CZJ6-1", "uniprot_ac": "Q9CZJ6", "uniprot_id": "MS18A_MOUSE", "mass": { "chemical_mass": 22949.0, "monoisotopic_mass": 22949.0 }, "refseq": { "ac": "NP_079918", "name": "protein Mis18-alpha", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079918" }, "gene_names": [ { "name": "Mis18a", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CZJ6", "id": "Q9CZJ6" }, { "name": "2610039C10Rik; 2810018N07Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079918", "id": "NP_079918" }, { "name": "Mis18a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079918", "id": "NP_079918" } ], "protein_names": [ { "name": "Protein Mis18-alpha", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CZJ6" }, { "name": "MIS18 kinetochore protein homolog A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079918", "id": "NP_079918" }, { "name": "protein Mis18-alpha", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079918", "id": "NP_079918" } ], "function": [ { "annotation": "Mis18alpha interacts with DNMT3A/3B, and this interaction is critical for maintaining DNA methylation and hence regulating epigenetic states of centromeric chromatin.", "evidence": [ { "database": "RefSeq", "id": "NP_079918", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079918" }, { "database": "PubMed", "id": "22516971", "url": "https://glygen.org/publication/PubMed/22516971" } ] }, { "annotation": "Mis18alpha is important for epidermal cell proliferation and stratification, because it is required for the deposition of CENP-A at the centromeric nucleosomes.", "evidence": [ { "database": "RefSeq", "id": "NP_079918", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079918" }, { "database": "PubMed", "id": "27670610", "url": "https://glygen.org/publication/PubMed/27670610" } ] }, { "annotation": "Required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6#function" }, { "database": "UniProtKB", "id": "Q9NYP9", "url": "https://www.uniprot.org/uniprot/Q9NYP9#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mis18a", "url": "https://www.uniprot.org/uniprot/Q9CZJ6", "locus": { "chromosome": "16", "start_pos": 90516200, "end_pos": 90524292, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000022978", "url": "https://www.ensembl.org/id/ENSMUSG00000022978" } ] } } ], "crossref": [ { "id": "ENSMUSG00000022978", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000022978", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "66578", "url": "https://www.ncbi.nlm.nih.gov/gene/66578", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR004910", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004910", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034752", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034752", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:66578", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66578", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1913828", "url": "http://www.informatics.jax.org/marker/MGI:1913828", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "EMKMLVM", "url": "https://omabrowser.org/oma/group/EMKMLVM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5490344at2759", "url": "http://www.orthodb.org/?query=5490344at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16431", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16431", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16431:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16431:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03226", "url": "http://pfam.xfam.org/family/PF03226", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CZJ6", "url": "http://purl.obolibrary.org/obo/PR_Q9CZJ6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-606279", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-606279", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_079918", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079918", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CZJ6-1", "url": "https://www.uniprot.org/uniprot/Q9CZJ6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSESPLLEKRLSEDSSRYLRLQKWANMSSADALGLEKERPEEKAAAAENPLVFLCARCRRPLGDSLTWVASQEDTNCILLRSVSCNVSVDKEPKLSKCRDEDGCILEALYCTGCSLSLGYVYRCTPKNLDYKRDLFCLSVEAVESYTLGSSEKQIVSEDKELFNLESRVEIEKSIKQMEEVLTALQKKLREVESKLSLASRGS", "length": 204, "header": "sp|Q9CZJ6-1|MS18A_MOUSE Isoform 1 of Protein Mis18-alpha OS=Mus musculus OX=10090 GN=Mis18a PE=2 SV=1 CANONICAL=Q9CZJ6-1" }, "isoforms": [ { "isoform_ac": "Q9CZJ6-1", "url": "", "sequence": { "sequence": "MSSESPLLEKRLSEDSSRYLRLQKWANMSSADALGLEKERPEEKAAAAENPLVFLCARCRRPLGDSLTWVASQEDTNCILLRSVSCNVSVDKEPKLSKCRDEDGCILEALYCTGCSLSLGYVYRCTPKNLDYKRDLFCLSVEAVESYTLGSSEKQIVSEDKELFNLESRVEIEKSIKQMEEVLTALQKKLREVESKLSLASRGS", "length": 204, "header": "sp|Q9CZJ6-1|MS18A_MOUSE Isoform 1 of Protein Mis18-alpha OS=Mus musculus OX=10090 GN=Mis18a PE=2 SV=1 CANONICAL=Q9CZJ6-1" }, "locus": { "chromosome": "16", "start_pos": 90524160, "end_pos": 90516789, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000099554", "url": "https://www.ensembl.org/id/ENSMUST00000099554" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000097150", "url": "https://www.ensembl.org/id/ENSMUSP00000097150" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "site_lbl": "Ser13" }, { "start_pos": 16, "end_pos": 16, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "site_lbl": "Ser16" }, { "start_pos": 17, "end_pos": 17, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "site_lbl": "Ser17" }, { "start_pos": 204, "end_pos": 204, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "site_lbl": "Ser204" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Roles of Mis18alpha in epigenetic regulation of centromeric chromatin and CENP-A loading.", "journal": "Molecular cell", "date": "2012", "authors": "Kim IS, Lee M, Park KC, Jeon Y, Park JH, Hwang EJ, Jeon TI, Ko S, Lee H, Baek SH, Kim KI", "evidence": [ { "database": "RefSeq", "id": "NP_079918", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079918" } ], "reference": [ { "type": "PubMed", "id": "22516971", "url": "https://glygen.org/publication/PubMed/22516971" } ] }, { "title": "Skin-Specific Deletion of Mis18alpha Impedes Proliferation and Stratification of Epidermal Keratinocytes.", "journal": "The Journal of investigative dermatology", "date": "2017", "authors": "Park KC, Lee M, Jeon Y, Jeon R, Baek SH, Lee H, Kim KI", "evidence": [ { "database": "RefSeq", "id": "NP_079918", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079918" } ], "reference": [ { "type": "PubMed", "id": "27670610", "url": "https://glygen.org/publication/PubMed/27670610" } ] } ], "pathway": [ { "id": "mmu:66578", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66578", "resource": "KEGG Pathway" }, { "id": "R-MMU-606279", "name": "Deposition of new CENPA-containing nucleosomes at the centromere", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-606279", "resource": "Reactome", "description": "Deposition of new CENPA-containing nucleosomes at the centromere" } ], "orthologs": [ { "uniprot_canonical_ac": "B2RZC4-1", "protein_name": "Protein Mis18-alpha", "gene_name": "Mis18a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAGTFSLEPCSTSSSCNHQGKRSESSLLEKRLSEDSSRHWRLQKWASMSSADASRTLLERREEKAAAAENPLVFLCTRCRRPLGDSLTWVASQEDTNCILLRSVSSNVSVDKEQKLSKCRDEDGCILETLYCSGCSLSLGYVYRCTPKNLDYKRNLFCLSVEAVESYTLGSSEQQIVSEEEFFNLESRVEIEKSIKQMEDVLTVMQAKLWEVESKLSKAGRYS", "length": 223 }, "evidence": [ { "id": "45231096", "url": "http://www.informatics.jax.org/homology/45231096", "database": "MGI" }, { "id": "Q9CZJ6", "url": "https://omabrowser.org/oma/group/Q9CZJ6/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9NYP9-1", "protein_name": "Protein Mis18-alpha", "gene_name": "MIS18A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLEEEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLCCAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATCKS", "length": 233 }, "evidence": [ { "id": "45231096", "url": "http://www.informatics.jax.org/homology/45231096", "database": "MGI" }, { "id": "Q9CZJ6", "url": "https://omabrowser.org/oma/group/Q9CZJ6/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "pmid": "" }, { "name": "chromosome, centromeric region", "id": "GO:0000775", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000775", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "chromosome segregation", "id": "GO:0007059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007059", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "pmid": "" }, { "name": "regulation of DNA methylation", "id": "GO:0044030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044030", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "pmid": "" }, { "name": "CENP-A containing chromatin assembly", "id": "GO:0034080", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034080", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q9CZJ6", "url": "https://www.uniprot.org/uniprot/Q9CZJ6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 27, "end_pos": 29, "annotation": "n_glycosylation_sequon" }, { "start_pos": 87, "end_pos": 89, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }