{ "uniprot_canonical_ac": "Q9CYZ8-1", "uniprot_ac": "Q9CYZ8", "uniprot_id": "SSBP2_MOUSE", "mass": { "chemical_mass": 37846.0, "monoisotopic_mass": 37846.0 }, "refseq": { "ac": "NP_077148", "name": "single-stranded DNA-binding protein 2 isoform 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077148" }, "gene_names": [ { "name": "Ssbp2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CYZ8", "id": "Q9CYZ8" }, { "name": "1500004K09Rik; 2310079I02Rik; 9330163K02Rik; A830008M03Rik; Hspc116; SSDP2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077148", "id": "NP_077148" }, { "name": "Ssbp2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077148", "id": "NP_077148" }, { "name": "Ssdp2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9CYZ8", "id": "Q9CYZ8" } ], "protein_names": [ { "name": "Single-stranded DNA-binding protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CYZ8" }, { "name": "Sequence-specific single-stranded-DNA-binding protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CYZ8" }, { "name": "sequence-specific single-stranded-DNA-binding protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077148", "id": "NP_077148" }, { "name": "single-stranded DNA-binding protein 2 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077148", "id": "NP_077148" } ], "function": [ { "annotation": "GWAS in Mice Maps Susceptibility to HIV-Associated Nephropathy to the Ssbp2 Locus.", "evidence": [ { "database": "RefSeq", "id": "NP_077148", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077148" }, { "database": "PubMed", "id": "34893534", "url": "https://glygen.org/publication/PubMed/34893534" } ] }, { "annotation": "The results uncovered a critical regulatory function for SSBP2 in hematopoietic stem and progenitor cells gene expression and function.", "evidence": [ { "database": "RefSeq", "id": "NP_077148", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077148" }, { "database": "PubMed", "id": "25238756", "url": "https://glygen.org/publication/PubMed/25238756" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs3389302615", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3389302615" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 356, "end_pos": 356, "sequence_org": "S", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->I).", "chr_id": "13", "chr_pos": "91848795", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S356", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CYZ8", "url": "https://www.uniprot.org/uniprot/Q9CYZ8" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ssbp2", "url": "https://www.uniprot.org/uniprot/Q9CYZ8", "locus": { "chromosome": "13", "start_pos": 91851548, "end_pos": 91608402, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000003992", "url": "https://www.ensembl.org/id/ENSMUSG00000003992" } ] } } ], "crossref": [ { "id": "ENSMUSG00000003992", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000003992", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "66970", "url": "https://www.ncbi.nlm.nih.gov/gene/66970", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9CYZ8", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9CYZ8*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006594", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006594", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:66970", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66970", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1914220", "url": "http://www.informatics.jax.org/marker/MGI:1914220", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9CYZ8", "url": "https://oglcnac.org/atlas/detail/Q9CYZ8", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "GMPGMNX", "url": "https://omabrowser.org/oma/group/GMPGMNX/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4371601at2759", "url": "http://www.orthodb.org/?query=4371601at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12610", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12610", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12610:SF23", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12610:SF23", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04503", "url": "http://pfam.xfam.org/family/PF04503", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CYZ8", "url": "http://purl.obolibrary.org/obo/PR_Q9CYZ8", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_077148", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077148", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A338P6Q9", "url": "https://www.uniprot.org/uniprot/A0A338P6Q9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A338P6Q9-1", "url": "https://www.uniprot.org/uniprot/A0A338P6Q9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RG78", "url": "https://www.uniprot.org/uniprot/D6RG78", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RG78-1", "url": "https://www.uniprot.org/uniprot/D6RG78-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CYZ8", "url": "https://www.uniprot.org/uniprot/Q9CYZ8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CYZ8-1", "url": "https://www.uniprot.org/uniprot/Q9CYZ8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CYZ8-2", "url": "https://www.uniprot.org/uniprot/Q9CYZ8-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNMPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMSV", "length": 361, "header": "sp|Q9CYZ8-1|SSBP2_MOUSE Isoform 1 of Single-stranded DNA-binding protein 2 OS=Mus musculus OX=10090 GN=Ssbp2 PE=1 SV=1 CANONICAL=Q9CYZ8-1" }, "isoforms": [ { "isoform_ac": "A0A338P6Q9-1", "url": "", "sequence": { "sequence": "MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNMPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQSDPWLSLQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSAS", "length": 244, "header": "tr|A0A338P6Q9-1|SSBP2_MOUSE Computationally mapped isoform of Single-stranded DNA-binding protein 2 OS=Mus musculus OX=10090 GN=Ssbp2 PE=1 SV=1 CANONICAL=Q9CYZ8-1" }, "locus": { "chromosome": "13", "start_pos": 91831821, "end_pos": 91609306, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000231481.2", "url": "https://www.ensembl.org/id/ENSMUST00000231481.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000156076.2", "url": "https://www.ensembl.org/id/ENSMUSP00000156076.2" } ] } }, { "isoform_ac": "D6RG78-1", "url": "", "sequence": { "sequence": "MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEGFSV", "length": 49, "header": "tr|D6RG78-1|SSBP2_MOUSE Computationally mapped isoform of Single-stranded DNA-binding protein 2 OS=Mus musculus OX=10090 GN=Ssbp2 PE=1 SV=1 CANONICAL=Q9CYZ8-1" }, "locus": { "chromosome": "13", "start_pos": 91682107, "end_pos": 91609306, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000138488.2", "url": "https://www.ensembl.org/id/ENSMUST00000138488.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000115548.2", "url": "https://www.ensembl.org/id/ENSMUSP00000115548.2" } ] } }, { "isoform_ac": "Q9CYZ8-1", "url": "", "sequence": { "sequence": "MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNMPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMSV", "length": 361, "header": "sp|Q9CYZ8-1|SSBP2_MOUSE Isoform 1 of Single-stranded DNA-binding protein 2 OS=Mus musculus OX=10090 GN=Ssbp2 PE=1 SV=1 CANONICAL=Q9CYZ8-1" }, "locus": { "chromosome": "13", "start_pos": 91848811, "end_pos": 91609306, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000004094", "url": "https://www.ensembl.org/id/ENSMUST00000004094" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000004094", "url": "https://www.ensembl.org/id/ENSMUSP00000004094" } ] } }, { "isoform_ac": "Q9CYZ8-2", "url": "", "sequence": { "sequence": "MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMSV", "length": 331, "header": "sp|Q9CYZ8-2|SSBP2_MOUSE Isoform 2 of Single-stranded DNA-binding protein 2 OS=Mus musculus OX=10090 GN=Ssbp2 PE=1 SV=1 CANONICAL=Q9CYZ8-1" }, "locus": { "chromosome": "13", "start_pos": 91848811, "end_pos": 91609306, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000042122", "url": "https://www.ensembl.org/id/ENSMUST00000042122" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000037115", "url": "https://www.ensembl.org/id/ENSMUSP00000037115" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 350, "start_aa": "Ser", "end_pos": 350, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser350", "evidence": [ { "id": "Q9CYZ8", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9CYZ8" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 352, "start_aa": "Ser", "end_pos": 352, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser352", "evidence": [ { "id": "Q9CYZ8", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9CYZ8" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 354, "start_aa": "Ser", "end_pos": 354, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser354", "evidence": [ { "id": "Q9CYZ8", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9CYZ8" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 356, "start_aa": "Ser", "end_pos": 356, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser356", "evidence": [ { "id": "Q9CYZ8", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9CYZ8" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 358, "start_aa": "Thr", "end_pos": 358, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr358", "evidence": [ { "id": "Q9CYZ8", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9CYZ8" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 360, "start_aa": "Ser", "end_pos": 360, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser360", "evidence": [ { "id": "Q9CYZ8", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9CYZ8" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] } ], "phosphorylation": [ { "start_pos": 321, "end_pos": 321, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9CYZ8", "url": "https://www.uniprot.org/uniprot/Q9CYZ8" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9CYZ8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9CYZ8" } ], "site_lbl": "Ser321" }, { "start_pos": 333, "end_pos": 333, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9CYZ8", "url": "https://www.uniprot.org/uniprot/Q9CYZ8" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9CYZ8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9CYZ8" } ], "site_lbl": "Thr333" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9CYZ8", "url": "https://www.uniprot.org/uniprot/Q9CYZ8" }, { "database": "iPTMnet", "id": "Q9CYZ8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9CYZ8" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "D6RG78", "url": "https://www.uniprot.org/uniprot/D6RG78" }, { "database": "UniProtKB", "id": "A0A338P6Q9", "url": "https://www.uniprot.org/uniprot/A0A338P6Q9" }, { "database": "UniProtKB", "id": "Q9CYZ8", "url": "https://www.uniprot.org/uniprot/Q9CYZ8" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", "journal": "Mol. Cell. Proteomics", "date": "2014", "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "Q9CYZ8", "url": "https://www.uniprot.org/uniprot/Q9CYZ8" } ], "reference": [ { "type": "PubMed", "id": "24129315", "url": "https://glygen.org/publication/PubMed/24129315" } ] }, { "title": "Requirement for ssbp2 in hematopoietic stem cell maintenance and stress response.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2014", "authors": "Li J, Kurasawa Y, Wang Y, Clise-Dwyer K, Klumpp SA, Liang H, Tailor RC, Raymond AC, Estrov Z, Brandt SJ, Davis RE, Zweidler-McKay P, Amin HM, Nagarajan L", "evidence": [ { "database": "RefSeq", "id": "NP_077148", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077148" } ], "reference": [ { "type": "PubMed", "id": "25238756", "url": "https://glygen.org/publication/PubMed/25238756" } ] }, { "title": "Age-related loss of neural stem cell O-GlcNAc promotes a glial fate switch through STAT3 activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "White CW 3rd, Fan X, Maynard JC, Wheatley EG, Bieri G, Couthouis J, Burlingame AL, Villeda SA", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "Q9CYZ8", "url": "https://oglcnac.org/atlas/detail/Q9CYZ8" } ], "reference": [ { "type": "PubMed", "id": "32848054", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "title": "GWAS in Mice Maps Susceptibility to HIV-Associated Nephropathy to the Ssbp2 Locus.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2022", "authors": "Steers NJ, Gupta Y, D'Agati VD, Lim TY, DeMaria N, Mo A, Liang J, Stevens KO, Ahram DF, Lam WY, Gagea M, Nagarajan L, Sanna-Cherchi S, Gharavi AG", "evidence": [ { "database": "RefSeq", "id": "NP_077148", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077148" } ], "reference": [ { "type": "PubMed", "id": "34893534", "url": "https://glygen.org/publication/PubMed/34893534" } ] } ], "pathway": [ { "id": "mmu:66970", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66970", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P81877-1", "protein_name": "Single-stranded DNA-binding protein 2", "gene_name": "SSBP2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MYGKGKSNSSAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFWDLYCAAPERRETCEHSSEAKAFHDYSAAAAPSPVLGNIPPGDGMPVGPVPPGFFQPFMSPRYPGGPRPPLRIPNQALGGVPGSQPLLPSGMDPTRQQGHPNMGGPMQRMTPPRGMVPLGPQNYGGAMRPPLNALGGPGMPGMNMGPGGGRPWPNPTNANSIPYSSASPGNYVGPPGGGGPPGTPIMPSPADSTNSGDNMYTLMNAVPPGPNRPNFPMGPGSDGPMGGLGGMESHHMNGSLGSGDMDSISKNSPNNMSLSNQPGTPRDDGEMGGNFLNPFQSESYSPSMTMSV", "length": 361 }, "evidence": [ { "id": "45239135", "url": "http://www.informatics.jax.org/homology/45239135", "database": "MGI" }, { "id": "Q9CYZ8", "url": "https://omabrowser.org/oma/group/Q9CYZ8/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9CYZ8", "url": "https://www.uniprot.org/uniprot/Q9CYZ8" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9CYZ8", "url": "https://www.uniprot.org/uniprot/Q9CYZ8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "single-stranded DNA binding", "id": "GO:0003697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003697", "evidence": [ { "database": "UniProtKB", "id": "Q9CYZ8", "url": "https://www.uniprot.org/uniprot/Q9CYZ8" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "Q9CYZ8", "url": "https://www.uniprot.org/uniprot/Q9CYZ8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 306, "end_pos": 308, "annotation": "n_glycosylation_sequon" }, { "start_pos": 324, "end_pos": 326, "annotation": "n_glycosylation_sequon" }, { "start_pos": 51, "end_pos": 53, "annotation": "n_glycosylation_sequon" }, { "start_pos": 8, "end_pos": 10, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }