{
    "uniprot_canonical_ac": "Q9CYV5-1",
    "uniprot_ac": "Q9CYV5",
    "uniprot_id": "TM135_MOUSE",
    "mass": {
        "chemical_mass": 52364.0,
        "monoisotopic_mass": 52364.0
    },
    "refseq": {
        "ac": "NP_082619",
        "name": "transmembrane protein 135 isoform a",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
    },
    "gene_names": [
        {
            "name": "Tmem135",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9CYV5",
            "id": "Q9CYV5"
        },
        {
            "name": "2810439K08Rik; PMP52",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619",
            "id": "NP_082619"
        },
        {
            "name": "Tmem135",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619",
            "id": "NP_082619"
        }
    ],
    "protein_names": [
        {
            "name": "Transmembrane protein 135",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9CYV5"
        },
        {
            "name": "PMP52",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9CYV5"
        },
        {
            "name": "Peroxisomal membrane protein 52",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9CYV5"
        },
        {
            "name": "peroxisomal membrane protein 52",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619",
            "id": "NP_082619"
        },
        {
            "name": "transmembrane protein 135 isoform a",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619",
            "id": "NP_082619"
        }
    ],
    "function": [
        {
            "annotation": "A mutation in transmembrane protein 135 impairs lipid metabolism in mouse eyecups. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                },
                {
                    "database": "PubMed",
                    "id": "35031662",
                    "url": "https://glygen.org/publication/PubMed/35031662"
                }
            ]
        },
        {
            "annotation": "Involved in mitochondrial metabolism by regulating the balance between mitochondrial fusion and fission (PubMed:27863209). May act as a regulator of mitochondrial fission that promotes DNM1L-dependent fission through activation of DNM1L (PubMed:27863209). May be involved in peroxisome organization (By similarity).",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9CYV5",
                    "url": "https://www.uniprot.org/uniprot/Q9CYV5#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "Q5U4F4",
                    "url": "https://www.uniprot.org/uniprot/Q5U4F4#function"
                },
                {
                    "database": "PubMed",
                    "id": "27863209",
                    "url": "https://glygen.org/publication/PubMed/27863209"
                }
            ]
        },
        {
            "annotation": "Metabolic alterations caused by the mutation and overexpression of the Tmem135 gene.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                },
                {
                    "database": "PubMed",
                    "id": "32515224",
                    "url": "https://glygen.org/publication/PubMed/32515224"
                }
            ]
        },
        {
            "annotation": "Modulation of Tmem135 Leads to Retinal Pigmented Epithelium Pathologies in Mice.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                },
                {
                    "database": "PubMed",
                    "id": "33064130",
                    "url": "https://glygen.org/publication/PubMed/33064130"
                }
            ]
        },
        {
            "annotation": "TMEM135 integrates biological processes involving fat metabolism and energy expenditure in both the worm (invertebrates) and in mammalian organisms Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                },
                {
                    "database": "PubMed",
                    "id": "21151927",
                    "url": "https://glygen.org/publication/PubMed/21151927"
                }
            ]
        },
        {
            "annotation": "The authors observed localization of TMEM135 on mitochondria, and imbalance of mitochondrial fission and fusion in mutant Tmem135 as well as Tmem135 overexpressing cells, indicating that TMEM135 is involved in the regulation of mitochondrial dynamics. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                },
                {
                    "database": "PubMed",
                    "id": "27863209",
                    "url": "https://glygen.org/publication/PubMed/27863209"
                }
            ]
        },
        {
            "annotation": "Transmembrane protein 135 regulates lipid homeostasis through its role in peroxisomal DHA metabolism. Publication Status: Online-Only",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                },
                {
                    "database": "PubMed",
                    "id": "36599953",
                    "url": "https://glygen.org/publication/PubMed/36599953"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9CYV5",
                    "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Tmem135",
            "url": "https://www.uniprot.org/uniprot/Q9CYV5",
            "locus": {
                "chromosome": "7",
                "start_pos": 88788922,
                "end_pos": 89053430,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000039428",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000039428"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000039428",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000039428",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "72759",
            "url": "https://www.ncbi.nlm.nih.gov/gene/72759",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR026749",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR026749",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR031926",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR031926",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:72759",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72759",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1920009",
            "url": "http://www.informatics.jax.org/marker/MGI:1920009",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "TDKCVNA",
            "url": "https://omabrowser.org/oma/group/TDKCVNA/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "4611717at2759",
            "url": "http://www.orthodb.org/?query=4611717at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12459",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12459",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR12459:SF6",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12459:SF6",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF02466",
            "url": "http://pfam.xfam.org/family/PF02466",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF15982",
            "url": "http://pfam.xfam.org/family/PF15982",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q9CYV5",
            "url": "http://purl.obolibrary.org/obo/PR_Q9CYV5",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_082619",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "D3YUX0",
            "url": "https://www.uniprot.org/uniprot/D3YUX0",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "D3YUX0-1",
            "url": "https://www.uniprot.org/uniprot/D3YUX0-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8C8G3",
            "url": "https://www.uniprot.org/uniprot/Q8C8G3",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q8C8G3-1",
            "url": "https://www.uniprot.org/uniprot/Q8C8G3-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9CYV5",
            "url": "https://www.uniprot.org/uniprot/Q9CYV5",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9CYV5-1",
            "url": "https://www.uniprot.org/uniprot/Q9CYV5-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MAALSKSIPHNCYEIGHTWHPSCRVSFLQITWGALEESLRIYAPLYLIAAVLRKRKLEYYLYKLLPEILQSASFLTANGALYITFFCILRKILGKFYSWTPGFGAALPASYVAILIERKSRRGLLTIYMANLATETLFRMGVARGTITTLRNGEVLLFCITAAMYMFFFRCKDGLKGFTFSALRFIVGKEEIPTHSYSPETAYAKVEQKREKHKGTPRAMSIIALVRTLVDSVCKHGPRHRCCKHYEDNCISYCIKGFIRMFSVGYLIQCCLRIPSAFRHLFTEPSRLLSLFYNKENFQLGAFLGSFVSIYKGTSCFLRWIRNLDDELHAIVAGFLAGVSMMFYKSTTISMYLASKLVETMYFKGIEAGKVPYFPQADTIIYSISTAICFHAAVMEVQNLRPSYWKFLLRLTKGRFALMNRKALDVFGTGASREFHNFIPRLDPRYTVVTPELPIDFS",
        "length": 458,
        "header": "sp|Q9CYV5-1|TM135_MOUSE Isoform 1 of Transmembrane protein 135  OS=Mus musculus OX=10090 GN=Tmem135 PE=2 SV=1 CANONICAL=Q9CYV5-1"
    },
    "isoforms": [
        {
            "isoform_ac": "D3YUX0-1",
            "url": "",
            "sequence": {
                "sequence": "MAALSKSIPHNCYEIGHTWHPSCRVSFLQITWGALEESLRIYAPLYLIAAVLRKRKLEYYLYKLLPEILQSASFLTANGALYITFFCILRSINICGRVWWHMALIAALKWLRS",
                "length": 113,
                "header": "tr|D3YUX0-1|TM135_MOUSE Computationally mapped isoform of Transmembrane protein 135  OS=Mus musculus OX=10090 GN=Tmem135 PE=2 SV=1 CANONICAL=Q9CYV5-1"
            },
            "locus": {
                "chromosome": "7",
                "start_pos": 88987796,
                "end_pos": 88954677,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000137723.2",
                        "url": "https://www.ensembl.org/id/ENSMUST00000137723.2"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000114866.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000114866.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q8C8G3-1",
            "url": "",
            "sequence": {
                "sequence": "MAALSKSIPHNCYEIGHTWHPSCRVSFLQITWGALEESLRIYAPLYLIAAVLRKRKLEYYLYKLLPEILQSASFLTANGALYITFFCILRKILGKFYSWTPGFGAALPASYVAILIERKSRRGLLTIYMANLATETLFRMGVARGTITTLRNGEVLLFCITAAMYMFFFRCKDGLKGFTFSALRFIVGKEEIPTHSYSPETAYAKVEQKREKHKGTPRAMSIIALVRTLVDSVCKHGPRHRCCKHYEDNCISYCIKGFIRMFSVGYLIQCCLRIPSAFRHLFTEPSRLLSLFYNKENFQLGAFLGSFVSIYKGTSCFLRWIRNLDDELHAIVAGFLAGVSMMFYKSTTISMYLASKLVEKNTESTMPMSTR",
                "length": 371,
                "header": "tr|Q8C8G3-1|TM135_MOUSE Computationally mapped isoform of Transmembrane protein 135  OS=Mus musculus OX=10090 GN=Tmem135 PE=2 SV=1 CANONICAL=Q9CYV5-1"
            },
            "locus": {
                "chromosome": "7",
                "start_pos": 88987796,
                "end_pos": 88796982,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000117852.8",
                        "url": "https://www.ensembl.org/id/ENSMUST00000117852.8"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000114097.2",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000114097.2"
                    }
                ]
            }
        },
        {
            "isoform_ac": "Q9CYV5-1",
            "url": "",
            "sequence": {
                "sequence": "MAALSKSIPHNCYEIGHTWHPSCRVSFLQITWGALEESLRIYAPLYLIAAVLRKRKLEYYLYKLLPEILQSASFLTANGALYITFFCILRKILGKFYSWTPGFGAALPASYVAILIERKSRRGLLTIYMANLATETLFRMGVARGTITTLRNGEVLLFCITAAMYMFFFRCKDGLKGFTFSALRFIVGKEEIPTHSYSPETAYAKVEQKREKHKGTPRAMSIIALVRTLVDSVCKHGPRHRCCKHYEDNCISYCIKGFIRMFSVGYLIQCCLRIPSAFRHLFTEPSRLLSLFYNKENFQLGAFLGSFVSIYKGTSCFLRWIRNLDDELHAIVAGFLAGVSMMFYKSTTISMYLASKLVETMYFKGIEAGKVPYFPQADTIIYSISTAICFHAAVMEVQNLRPSYWKFLLRLTKGRFALMNRKALDVFGTGASREFHNFIPRLDPRYTVVTPELPIDFS",
                "length": 458,
                "header": "sp|Q9CYV5-1|TM135_MOUSE Isoform 1 of Transmembrane protein 135  OS=Mus musculus OX=10090 GN=Tmem135 PE=2 SV=1 CANONICAL=Q9CYV5-1"
            },
            "locus": {
                "chromosome": "7",
                "start_pos": 88987796,
                "end_pos": 88791049,
                "strand": "+",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000041968",
                        "url": "https://www.ensembl.org/id/ENSMUST00000041968"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000042783",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000042783"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Proteomics characterization of mouse kidney peroxisomes by tandem mass spectrometry and protein correlation profiling.",
            "journal": "Mol. Cell. Proteomics",
            "date": "2007",
            "authors": "Berger J., Erdmann R., Wanders R.J., Azevedo J.E., Waterham H.R., Ofman R., Meyer H.E., Warscheid B., Wiese S., Schliebs W., Stephan C., Just W., Korosec T., Kunze M., Grou C.P., Almeida J.A., Eisenacher M., Gronemeyer T., Hayen H., Schollenberger L.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9CYV5",
                    "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17768142",
                    "url": "https://glygen.org/publication/PubMed/17768142"
                }
            ]
        },
        {
            "title": "Stressed-induced TMEM135 protein is part of a conserved genetic network involved in fat storage and longevity regulation in Caenorhabditis elegans.",
            "journal": "PLoS ONE",
            "date": "2010",
            "authors": "Exil VJ, Silva Avila D, Benedetto A, Exil EA, Adams MR, Au C, Aschner M",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9CYV5",
                    "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                },
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21151927",
                    "url": "https://glygen.org/publication/PubMed/21151927"
                }
            ]
        },
        {
            "title": "Mouse Tmem135 mutation reveals a mechanism involving mitochondrial dynamics that leads to age-dependent retinal pathologies.",
            "journal": "eLife",
            "date": "2016",
            "authors": "Lee WH, Higuchi H, Ikeda S, Macke EL, Takimoto T, Pattnaik BR, Liu C, Chu LF, Siepka SM, Krentz KJ, Rubinstein CD, Kalejta RF, Thomson JA, Mullins RF, Takahashi JS, Pinto LH, Ikeda A",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "27863209",
                    "url": "https://glygen.org/publication/PubMed/27863209"
                }
            ]
        },
        {
            "title": "Metabolic alterations caused by the mutation and overexpression of the Tmem135 gene.",
            "journal": "Experimental biology and medicine (Maywood, N.J.)",
            "date": "2020",
            "authors": "Lee WH, Bhute VJ, Higuchi H, Ikeda S, Palecek SP, Ikeda A",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32515224",
                    "url": "https://glygen.org/publication/PubMed/32515224"
                }
            ]
        },
        {
            "title": "Modulation of Tmem135 Leads to Retinal Pigmented Epithelium Pathologies in Mice.",
            "journal": "Investigative ophthalmology & visual science",
            "date": "2020",
            "authors": "Landowski M, Grindel S, Shahi PK, Johnson A, Western D, Race A, Shi F, Benson J, Gao M, Santoirre E, Lee WH, Ikeda S, Pattnaik BR, Ikeda A",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "33064130",
                    "url": "https://glygen.org/publication/PubMed/33064130"
                }
            ]
        },
        {
            "title": "A mutation in transmembrane protein 135 impairs lipid metabolism in mouse eyecups.",
            "journal": "Scientific reports",
            "date": "2022",
            "authors": "Landowski M, Bhute VJ, Takimoto T, Grindel S, Shahi PK, Pattnaik BR, Ikeda S, Ikeda A",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "35031662",
                    "url": "https://glygen.org/publication/PubMed/35031662"
                }
            ]
        },
        {
            "title": "Transmembrane protein 135 regulates lipid homeostasis through its role in peroxisomal DHA metabolism.",
            "journal": "Communications biology",
            "date": "2023-01-04",
            "authors": "Landowski Michael, Bhute Vijesh J, Grindel Samuel, Haugstad Zachary, Gyening Yeboah K, Tytanic Madison, Brush Richard S, Moyer Lucas J, Nelson David W, Davis Christopher R, Yen Chi-Liang Eric, Ikeda Sakae, Agbaga Martin-Paul, Ikeda Akihiro",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082619",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082619"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "36599953",
                    "url": "https://glygen.org/publication/PubMed/36599953"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:72759",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72759",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q5U4F4-1",
            "protein_name": "Transmembrane protein 135",
            "gene_name": "Tmem135",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MAALSKSIPHNCYEIGHTWNPSCRVSFLQITWGALEESLRIYAPLYLIAAVLRKRKLEYYLYKLLPEILQSASFLTANGALYITFFCVLRKILGKFYSWTPGFGAALPASYVAILIERKSRRGLLTIYMANLATETLFRMGVARGTITTLRNGEVLLFCITAAMYMFFFRCKDGLKGFTFSALRFIVGKEEIPTHSYSPETAYAKVEQKREKHRGTTRAMSLIALVRSLVDSICKHGPRHRCCKHYEDNCISYCIKGFIRMFSVGYLIQCCLRIPSAFRHLFTEPSRLLSLFYNKENFQLGAFLGSFVSIYKGTSCFLRWIRNLDDELHAIVAGFLAGVSMMFYKSTTISMYLASKLVETMYFKGIEAGKVPYFPQADTIIYSISTAICFHAAVMEVQNLRPSYWKFLLRLTKGRFALMNRKALDVFGTGASREFHNFIPRLDPRYTVVTPELPIDFS",
                "length": 458
            },
            "evidence": [
                {
                    "id": "45234432",
                    "url": "http://www.informatics.jax.org/homology/45234432",
                    "database": "MGI"
                },
                {
                    "id": "Q9CYV5",
                    "url": "https://omabrowser.org/oma/group/Q9CYV5/",
                    "database": "OMA"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q86UB9-1",
            "protein_name": "Transmembrane protein 135",
            "gene_name": "TMEM135",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MAALSKSIPHNCYEIGHTWHPSCRVSFLQITGGALEESLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFCILRKILGKFYSWTPGFGAALPASYVAILIERKSRRGLLTIYMANLATETLFRMGVARGTITTLRNGEVLLFCITAAMYMFFFRCKDGLKGFTFSALRFIVGKEEIPTHSFSPEAAYAKVEQKREQHEEKPGRMNMIGLVRKFVDSICKHGPRHRCCKHYEDNCISYCIKGFIRMFSVGYLIQCCLRIPSAFRHLFTQPSRLLSLFYNKENFQLGAFLGSFVSIYKGTSCFLRWIRNLDDELHAIIAGFLAGISMMFYKSTTISMYLASKLVETMYFKGIEAGKVPYFPHADTIIYSISTAICFQAAVMEVQTLRPSYWKFLLRLTKGKFAVMNRKVLDVFGTGASKHFQDFIPRLDPRYTTVTPELPTEFS",
                "length": 458
            },
            "evidence": [
                {
                    "id": "45234432",
                    "url": "http://www.informatics.jax.org/homology/45234432",
                    "database": "MGI"
                },
                {
                    "id": "Q9CYV5",
                    "url": "https://omabrowser.org/oma/group/Q9CYV5/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 7,
                "go_terms": [
                    {
                        "name": "membrane",
                        "id": "GO:0016020",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "cytoplasm",
                        "id": "GO:0005737",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mitochondrion",
                        "id": "GO:0005739",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "peroxisome",
                        "id": "GO:0005777",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "peroxisomal membrane",
                        "id": "GO:0005778",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005778",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "lipid droplet",
                        "id": "GO:0005811",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005811",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mitochondrial membrane",
                        "id": "GO:0031966",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 11,
                "go_terms": [
                    {
                        "name": "regulation of mitochondrial fission",
                        "id": "GO:0090140",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090140",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "response to cold",
                        "id": "GO:0009409",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009409",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of gene expression",
                        "id": "GO:0010628",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "peroxisome organization",
                        "id": "GO:0007031",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007031",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of lipid storage",
                        "id": "GO:0010884",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010884",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "response to food",
                        "id": "GO:0032094",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032094",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of mitochondrial membrane potential",
                        "id": "GO:0010918",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010918",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "regulation of oxidative phosphorylation",
                        "id": "GO:0002082",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002082",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mitochondrion morphogenesis",
                        "id": "GO:0070584",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070584",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "determination of adult lifespan",
                        "id": "GO:0008340",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008340",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "retinal pigment epithelium development",
                        "id": "GO:0003406",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003406",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CYV5",
                                "url": "https://www.uniprot.org/uniprot/Q9CYV5"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "isoformset.uniprotkb",
            "label": "Isoforms"
        },
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}