{ "uniprot_canonical_ac": "Q9CX19-1", "uniprot_ac": "Q9CX19", "uniprot_id": "F162B_MOUSE", "mass": { "chemical_mass": 17686.0, "monoisotopic_mass": 17686.0 }, "refseq": { "ac": "NP_084170", "name": "protein FAM162B", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084170" }, "gene_names": [ { "name": "Fam162b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CX19", "id": "Q9CX19" }, { "name": "9430073N08Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084170", "id": "NP_084170" }, { "name": "Fam162b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084170", "id": "NP_084170" } ], "protein_names": [ { "name": "Protein FAM162B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CX19" }, { "name": "protein FAM162B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084170", "id": "NP_084170" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CX19", "url": "https://www.uniprot.org/uniprot/Q9CX19" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Fam162b", "url": "https://www.uniprot.org/uniprot/Q9CX19", "locus": { "chromosome": "10", "start_pos": 51461512, "end_pos": 51466613, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000019909", "url": "https://www.ensembl.org/id/ENSMUSG00000019909" } ] } } ], "crossref": [ { "id": "ENSMUSG00000019909", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000019909", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "77296", "url": "https://www.ncbi.nlm.nih.gov/gene/77296", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR009432", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009432", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:77296", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:77296", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1924546", "url": "http://www.informatics.jax.org/marker/MGI:1924546", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "KGRGEVH", "url": "https://omabrowser.org/oma/group/KGRGEVH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2970852at2759", "url": "http://www.orthodb.org/?query=2970852at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13674", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13674", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13674:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13674:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06388", "url": "http://pfam.xfam.org/family/PF06388", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CX19", "url": "http://purl.obolibrary.org/obo/PR_Q9CX19", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_084170", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084170", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9CX19", "url": "https://www.uniprot.org/uniprot/Q9CX19", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CX19-1", "url": "https://www.uniprot.org/uniprot/Q9CX19-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLWVSRSVLRLGLGFTTHRAPQIISRWPRWGPRVACHPCSSSGQNPSGFEPPEKVHRIPAQYKPSKFDKKILLWTGRFKSIEDIPPLVPPEMIAVSRNKARVKACYIMIGLTIVACFAVIVSAKRAVERHESLTSWNLAKKAKWREEAALAAQSKSK", "length": 157, "header": "sp|Q9CX19-1|F162B_MOUSE Isoform 1 of Protein FAM162B OS=Mus musculus OX=10090 GN=Fam162b PE=1 SV=1 CANONICAL=Q9CX19-1" }, "isoforms": [ { "isoform_ac": "Q9CX19-1", "url": "", "sequence": { "sequence": "MLWVSRSVLRLGLGFTTHRAPQIISRWPRWGPRVACHPCSSSGQNPSGFEPPEKVHRIPAQYKPSKFDKKILLWTGRFKSIEDIPPLVPPEMIAVSRNKARVKACYIMIGLTIVACFAVIVSAKRAVERHESLTSWNLAKKAKWREEAALAAQSKSK", "length": 157, "header": "sp|Q9CX19-1|F162B_MOUSE Isoform 1 of Protein FAM162B OS=Mus musculus OX=10090 GN=Fam162b PE=1 SV=1 CANONICAL=Q9CX19-1" }, "locus": { "chromosome": "10", "start_pos": 51466517, "end_pos": 51461591, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000020064", "url": "https://www.ensembl.org/id/ENSMUST00000020064" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000020064", "url": "https://www.ensembl.org/id/ENSMUSP00000020064" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "mmu:77296", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:77296", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q5T6X4-1", "protein_name": "Protein FAM162B", "gene_name": "FAM162B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MLRAVGSLLRLGRGLTVRCGPGAPLEATRRPAPALPPRGLPCYSSGGAPSNSGPQGHGEIHRVPTQRRPSQFDKKILLWTGRFKSMEEIPPRIPPEMIDTARNKARVKACYIMIGLTIIACFAVIVSAKRAVERHESLTSWNLAKKAKWREEAALAAQAKAK", "length": 162 }, "evidence": [ { "id": "45241198", "url": "http://www.informatics.jax.org/homology/45241198", "database": "MGI" }, { "id": "Q9CX19", "url": "https://omabrowser.org/oma/group/Q9CX19/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9CX19", "url": "https://www.uniprot.org/uniprot/Q9CX19" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }