{
    "uniprot_canonical_ac": "Q9CWH0-1",
    "uniprot_ac": "Q9CWH0",
    "uniprot_id": "DPPA2_MOUSE",
    "mass": {
        "chemical_mass": 34116.0,
        "monoisotopic_mass": 34116.0
    },
    "refseq": {
        "ac": "NP_082891",
        "name": "developmental pluripotency-associated protein 2",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
    },
    "gene_names": [
        {
            "name": "Dppa2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9CWH0",
            "id": "Q9CWH0"
        },
        {
            "name": "2410088E07Rik; D19Mgi18; ECAT15-2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891",
            "id": "NP_082891"
        },
        {
            "name": "Dppa2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891",
            "id": "NP_082891"
        },
        {
            "name": "Phsecrg1",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9CWH0",
            "id": "Q9CWH0"
        }
    ],
    "protein_names": [
        {
            "name": "Developmental pluripotency-associated protein 2",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9CWH0"
        },
        {
            "name": "ECAT15-2",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9CWH0"
        },
        {
            "name": "Embryonic stem cell-associated transcript 15-2 protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9CWH0"
        },
        {
            "name": "Pluripotent embryonic stem cell-related gene 1 protein",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9CWH0"
        },
        {
            "name": "developmental pluripotency-associated protein 2",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891",
            "id": "NP_082891"
        },
        {
            "name": "embryonic stem cell-associated transcript 15-2 protein; pluripotent embryonic stem cell-related gene 1 protein",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891",
            "id": "NP_082891"
        }
    ],
    "function": [
        {
            "annotation": "Binds to target gene promoters, including NKX2-5 and SYCE1, but not GATA4, and may be involved in the maintenance of the active epigenetic status of these genes.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9CWH0",
                    "url": "https://www.uniprot.org/uniprot/Q9CWH0#function"
                },
                {
                    "database": "PubMed",
                    "id": "21896782",
                    "url": "https://glygen.org/publication/PubMed/21896782"
                }
            ]
        },
        {
            "annotation": "DPPA2 and DPPA4 are dispensable for mouse zygotic genome activation and pre-implantation development.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                },
                {
                    "database": "PubMed",
                    "id": "34878123",
                    "url": "https://glygen.org/publication/PubMed/34878123"
                }
            ]
        },
        {
            "annotation": "Dppa2 and Dppa4 counteract de novo methylation to establish a permissive epigenome for development.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                },
                {
                    "database": "PubMed",
                    "id": "32572256",
                    "url": "https://glygen.org/publication/PubMed/32572256"
                }
            ]
        },
        {
            "annotation": "Dppa2/4 as a trigger of signaling pathways to promote zygote genome activation by binding to CG-rich region.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                },
                {
                    "database": "PubMed",
                    "id": "33316032",
                    "url": "https://glygen.org/publication/PubMed/33316032"
                }
            ]
        },
        {
            "annotation": "Maternal Dppa2 and Dppa4 are dispensable for zygotic genome activation but important for offspring survival.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                },
                {
                    "database": "PubMed",
                    "id": "34931676",
                    "url": "https://glygen.org/publication/PubMed/34931676"
                }
            ]
        },
        {
            "annotation": "Results showed that the expression of Dppa2 decreased markedly in differentiated cells. Dppa2 might play a role in maintenance of the undifferentiated state and proliferation of ES cells Erratum:[J Biochem. 2010 Jun;147(6):929]",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                },
                {
                    "database": "PubMed",
                    "id": "19846433",
                    "url": "https://glygen.org/publication/PubMed/19846433"
                }
            ]
        },
        {
            "annotation": "Study of expression and function of pluripotent markers such as Dppa2 and Dppa4 is likely to unveil new aspects of the regulation of pluripotency and germ line development in mammals.",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                },
                {
                    "database": "PubMed",
                    "id": "16990585",
                    "url": "https://glygen.org/publication/PubMed/16990585"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9CWH0",
                    "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Dppa2",
            "url": "https://www.uniprot.org/uniprot/Q9CWH0",
            "locus": {
                "chromosome": "16",
                "start_pos": 48140086,
                "end_pos": 48124271,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000072419",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000072419"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000072419",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000072419",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "73703",
            "url": "https://www.ncbi.nlm.nih.gov/gene/73703",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR025891",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR025891",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR025892",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR025892",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR039590",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR039590",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:73703",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:73703",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "2157523",
            "url": "http://www.informatics.jax.org/marker/MGI:2157523",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "FCPKHSC",
            "url": "https://omabrowser.org/oma/group/FCPKHSC/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "5260052at2759",
            "url": "http://www.orthodb.org/?query=5260052at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR16073",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16073",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR16073:SF10",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16073:SF10",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF14047",
            "url": "http://pfam.xfam.org/family/PF14047",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF14049",
            "url": "http://pfam.xfam.org/family/PF14049",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_Q9CWH0",
            "url": "http://purl.obolibrary.org/obo/PR_Q9CWH0",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_082891",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9CWH0",
            "url": "https://www.uniprot.org/uniprot/Q9CWH0",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9CWH0-1",
            "url": "https://www.uniprot.org/uniprot/Q9CWH0-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MSYFGLETFNENQSEENLDEESVILTLVPFKEEEEPNTDYATQSNVSSSTLDHTPPARSLVRHAGIKHPTRTIPSTCPPPSLPPIRDVSRNTLREWCRYHNLSTDGKKVEVYLRLRRHSYSKQECYIPNTSREARMKQGPKKSKIVFRGIGPPSGCQRKKEESGVLEILTSPKESTFAAWARIAMRAAQSMSKNRCPLPSNVEAFLPQATGSRWCVVHGRQLPADKKGWVRLQFLAGQTWVPDTPQRMNFLFLLPACIIPEPGVEDNLLCPECVHSNKKILRNFKIRSRAKKNALPPNMPP",
        "length": 301,
        "header": "sp|Q9CWH0-1|DPPA2_MOUSE Isoform 1 of Developmental pluripotency-associated protein 2  OS=Mus musculus OX=10090 GN=Dppa2 PE=1 SV=1 CANONICAL=Q9CWH0-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q9CWH0-1",
            "url": "",
            "sequence": {
                "sequence": "MSYFGLETFNENQSEENLDEESVILTLVPFKEEEEPNTDYATQSNVSSSTLDHTPPARSLVRHAGIKHPTRTIPSTCPPPSLPPIRDVSRNTLREWCRYHNLSTDGKKVEVYLRLRRHSYSKQECYIPNTSREARMKQGPKKSKIVFRGIGPPSGCQRKKEESGVLEILTSPKESTFAAWARIAMRAAQSMSKNRCPLPSNVEAFLPQATGSRWCVVHGRQLPADKKGWVRLQFLAGQTWVPDTPQRMNFLFLLPACIIPEPGVEDNLLCPECVHSNKKILRNFKIRSRAKKNALPPNMPP",
                "length": 301,
                "header": "sp|Q9CWH0-1|DPPA2_MOUSE Isoform 1 of Developmental pluripotency-associated protein 2  OS=Mus musculus OX=10090 GN=Dppa2 PE=1 SV=1 CANONICAL=Q9CWH0-1"
            },
            "locus": {
                "chromosome": "16",
                "start_pos": 48139071,
                "end_pos": 48130870,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000097175",
                        "url": "https://www.ensembl.org/id/ENSMUST00000097175"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000110183",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000110183"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "Incomplete reactivation of Oct4-related genes in mouse embryos cloned from somatic nuclei.",
            "journal": "Development",
            "date": "2003",
            "authors": "Page D.C., Skaletsky H., Jaenisch R., Akutsu H., Berry D.L., Bortvin A., Eggan K., Yanagimachi R.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9CWH0",
                    "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "12620990",
                    "url": "https://glygen.org/publication/PubMed/12620990"
                }
            ]
        },
        {
            "title": "Molecular cloning and characterization analysis of HPESCRG1, a novel gene expressed specifically in human embryonic stem cell.",
            "journal": "Zhonghua Yi Xue Yi Chuan Xue Za Zhi",
            "date": "2004",
            "authors": "Du J., Lin G., Lu G.X., Nie Z.Y.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9CWH0",
                    "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15583978",
                    "url": "https://glygen.org/publication/PubMed/15583978"
                }
            ]
        },
        {
            "title": "Dppa2 and Dppa4 are closely linked SAP motif genes restricted to pluripotent cells and the germ line.",
            "journal": "Stem cells (Dayton, Ohio)",
            "date": "2007",
            "authors": "Maldonado-Saldivia J, van den Bergen J, Krouskos M, Gilchrist M, Lee C, Li R, Sinclair AH, Surani MA, Western PS",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16990585",
                    "url": "https://glygen.org/publication/PubMed/16990585"
                }
            ]
        },
        {
            "title": "Dppa2 knockdown-induced differentiation and repressed proliferation of mouse embryonic stem cells.",
            "journal": "Journal of biochemistry",
            "date": "2010",
            "authors": "Du J, Chen T, Zou X, Xiong B, Lu G",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "19846433",
                    "url": "https://glygen.org/publication/PubMed/19846433"
                }
            ]
        },
        {
            "title": "Essential roles of ECAT15-2/Dppa2 in functional lung development.",
            "journal": "Mol. Cell. Biol.",
            "date": "2011",
            "authors": "Nakamura T, Nakagawa M, Ichisaka T, Shiota A, Yamanaka S",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9CWH0",
                    "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21896782",
                    "url": "https://glygen.org/publication/PubMed/21896782"
                }
            ]
        },
        {
            "title": "Dppa2 and Dppa4 counteract de novo methylation to establish a permissive epigenome for development.",
            "journal": "Nature structural & molecular biology",
            "date": "2020",
            "authors": "Gretarsson KH, Hackett JA",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "32572256",
                    "url": "https://glygen.org/publication/PubMed/32572256"
                }
            ]
        },
        {
            "title": "Dppa2/4 as a trigger of signaling pathways to promote zygote genome activation by binding to CG-rich region.",
            "journal": "Briefings in bioinformatics",
            "date": "2021",
            "authors": "Li H, Long C, Xiang J, Liang P, Li X, Zuo Y",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "33316032",
                    "url": "https://glygen.org/publication/PubMed/33316032"
                }
            ]
        },
        {
            "title": "DPPA2 and DPPA4 are dispensable for mouse zygotic genome activation and pre-implantation development.",
            "journal": "Development (Cambridge, England)",
            "date": "2021",
            "authors": "Chen Z, Xie Z, Zhang Y",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34878123",
                    "url": "https://glygen.org/publication/PubMed/34878123"
                }
            ]
        },
        {
            "title": "Maternal Dppa2 and Dppa4 are dispensable for zygotic genome activation but important for offspring survival.",
            "journal": "Development (Cambridge, England)",
            "date": "2021",
            "authors": "Kubinyecz O, Santos F, Drage D, Reik W, Eckersley-Maslin MA",
            "evidence": [
                {
                    "database": "RefSeq",
                    "id": "NP_082891",
                    "url": "https://www.ncbi.nlm.nih.gov/protein/NP_082891"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "34931676",
                    "url": "https://glygen.org/publication/PubMed/34931676"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "mmu:73703",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:73703",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "Q7Z7J5-1",
            "protein_name": "Developmental pluripotency-associated protein 2",
            "gene_name": "DPPA2",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK",
                "length": 298
            },
            "evidence": [
                {
                    "id": "45241089",
                    "url": "http://www.informatics.jax.org/homology/45241089",
                    "database": "MGI"
                },
                {
                    "id": "Q9CWH0",
                    "url": "https://omabrowser.org/oma/group/Q9CWH0/",
                    "database": "OMA"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 5,
                "go_terms": [
                    {
                        "name": "system development",
                        "id": "GO:0048731",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048731",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CWH0",
                                "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "positive regulation of stem cell proliferation",
                        "id": "GO:2000648",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000648",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CWH0",
                                "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "stem cell population maintenance",
                        "id": "GO:0019827",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019827",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CWH0",
                                "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "epigenetic regulation of gene expression",
                        "id": "GO:0040029",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040029",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CWH0",
                                "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "lung-associated mesenchyme development",
                        "id": "GO:0060484",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060484",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CWH0",
                                "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Molecular Function",
                "total": 1,
                "go_terms": [
                    {
                        "name": "chromatin binding",
                        "id": "GO:0003682",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CWH0",
                                "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CWH0",
                                "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nucleoplasm",
                        "id": "GO:0005654",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CWH0",
                                "url": "https://www.uniprot.org/uniprot/Q9CWH0"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 101,
            "end_pos": 103,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 129,
            "end_pos": 131,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 12,
            "end_pos": 14,
            "annotation": "n_glycosylation_sequon"
        },
        {
            "start_pos": 45,
            "end_pos": 47,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        },
        {
            "name": "homologset.oma",
            "label": "OMA Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 9
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}