{ "uniprot_canonical_ac": "Q9CWE6-1", "uniprot_ac": "Q9CWE6", "uniprot_id": "OOEP_MOUSE", "mass": { "chemical_mass": 18460.0, "monoisotopic_mass": 18460.0 }, "refseq": { "ac": "NP_080756", "name": "oocyte-expressed protein homolog", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756" }, "gene_names": [ { "name": "Ooep", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CWE6", "id": "Q9CWE6" }, { "name": "2410146L05Rik; Floped; Moep19; Sddr", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756", "id": "NP_080756" }, { "name": "Oep19", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9CWE6", "id": "Q9CWE6" }, { "name": "Ooep", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756", "id": "NP_080756" }, { "name": "Sddr", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9CWE6", "id": "Q9CWE6" } ], "protein_names": [ { "name": "Oocyte-expressed protein homolog", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CWE6" }, { "name": "Factor located in oocytes permitting embryonic development", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CWE6" }, { "name": "Floped", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CWE6" }, { "name": "Oocyte- and embryo-specific protein 19", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CWE6" }, { "name": "STAT3 downstream gene and differentiation regulator", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CWE6" }, { "name": "mOEP19", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CWE6" }, { "name": "oocyte and embryo specific protein; oocyte expressed protein homolog (dog); STAT3 downstream gene and differentiation regulator; oocyte- and embryo-specific protein 19; factor located in oocytes permitting embryonic development", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756", "id": "NP_080756" }, { "name": "oocyte-expressed protein homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756", "id": "NP_080756" } ], "function": [ { "annotation": "As part of the OOEP-KHDC3 scaffold, recruits BLM and TRIM25 to DNA replication forks, thereby promoting the ubiquitination of BLM by TRIM25, enhancing BLM retainment at replication forks and therefore promoting stalled replication fork restart (PubMed:29125140). Positively regulates the homologous recombination-mediated DNA double-strand break (DSB) repair pathway by regulating ATM activation and RAD51 recruitment to DSBs in oocytes (PubMed:29955025). Thereby contributes to oocyte survival and the resumption and completion of meiosis (PubMed:29955025). As a member of the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions via regulation of actin dynamics (PubMed:18804437, PubMed:25208553). Required for the formation of F-actin cytoplasmic lattices in oocytes which in turn are responsible for symmetric division of zygotes via the regulation of mitotic spindle formation and positioning (PubMed:25208553).", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6#function" }, { "database": "PubMed", "id": "18804437", "url": "https://glygen.org/publication/PubMed/18804437" }, { "database": "PubMed", "id": "25208553", "url": "https://glygen.org/publication/PubMed/25208553" }, { "database": "PubMed", "id": "29125140", "url": "https://glygen.org/publication/PubMed/29125140" }, { "database": "PubMed", "id": "29955025", "url": "https://glygen.org/publication/PubMed/29955025" } ] }, { "annotation": "MOEP19 domain directs RNAs essential for normal embryonic development to specific locations in the oocyte and early embryo.", "evidence": [ { "database": "RefSeq", "id": "NP_080756", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756" }, { "database": "PubMed", "id": "18191828", "url": "https://glygen.org/publication/PubMed/18191828" } ] }, { "annotation": "Results describe a subcortical maternal complex, containing Mater, Floped, TLE6, and Filia, that is essential for preimplantation mouse embryogenesis.", "evidence": [ { "database": "RefSeq", "id": "NP_080756", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756" }, { "database": "PubMed", "id": "18804437", "url": "https://glygen.org/publication/PubMed/18804437" } ] }, { "annotation": "The CES5/OOEP is an essential component of the oocyte cytoplasmic lattices and is required for embryonic development at the maternal-zygotic stage transition.", "evidence": [ { "database": "RefSeq", "id": "NP_080756", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756" }, { "database": "PubMed", "id": "20590823", "url": "https://glygen.org/publication/PubMed/20590823" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Ooep", "url": "https://www.uniprot.org/uniprot/Q9CWE6", "locus": { "chromosome": "9", "start_pos": 78283391, "end_pos": 78286007, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000032346", "url": "https://www.ensembl.org/id/ENSMUSG00000032346" } ] } } ], "crossref": [ { "id": "ENSMUSG00000032346", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000032346", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd12795", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12795", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "67968", "url": "https://www.ncbi.nlm.nih.gov/gene/67968", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9CWE6", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9CWE6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR031952", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031952", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036612", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036612", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:67968", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67968", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1915218", "url": "http://www.informatics.jax.org/marker/MGI:1915218", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "PWIRTRP", "url": "https://omabrowser.org/oma/group/PWIRTRP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4715737at2759", "url": "http://www.orthodb.org/?query=4715737at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19447", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19447", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19447:SF14", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19447:SF14", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF16005", "url": "http://pfam.xfam.org/family/PF16005", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CWE6", "url": "http://purl.obolibrary.org/obo/PR_Q9CWE6", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_080756", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CWE6-1", "url": "https://www.uniprot.org/uniprot/Q9CWE6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASHTADADAKPDSDSQKLLNVLPVSLRLRTRPWWFPIQEVSNPLVLYMEAWVAERVIGTDQAEISEIEWMCQALLTVDSVNSGNLAEITIFGQPSAQTRMKNILLNMAAWHKENELQRAVKVKEVEEFLKIRASSILSKLSKKGLKLAGFPLPLEGRETQMES", "length": 164, "header": "sp|Q9CWE6-1|OOEP_MOUSE Isoform 1 of Oocyte-expressed protein homolog OS=Mus musculus OX=10090 GN=Ooep PE=1 SV=1 CANONICAL=Q9CWE6-1" }, "isoforms": [ { "isoform_ac": "Q9CWE6-1", "url": "", "sequence": { "sequence": "MASHTADADAKPDSDSQKLLNVLPVSLRLRTRPWWFPIQEVSNPLVLYMEAWVAERVIGTDQAEISEIEWMCQALLTVDSVNSGNLAEITIFGQPSAQTRMKNILLNMAAWHKENELQRAVKVKEVEEFLKIRASSILSKLSKKGLKLAGFPLPLEGRETQMES", "length": 164, "header": "sp|Q9CWE6-1|OOEP_MOUSE Isoform 1 of Oocyte-expressed protein homolog OS=Mus musculus OX=10090 GN=Ooep PE=1 SV=1 CANONICAL=Q9CWE6-1" }, "locus": { "chromosome": "9", "start_pos": 78285810, "end_pos": 78284840, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000034900", "url": "https://www.ensembl.org/id/ENSMUST00000034900" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000034900", "url": "https://www.ensembl.org/id/ENSMUSP00000034900" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Distribution of RNA binding protein MOEP19 in the oocyte cortex and early embryo indicates pre-patterning related to blastomere polarity and trophectoderm specification.", "journal": "Developmental biology", "date": "2008", "authors": "Herr JC, Chertihin O, Digilio L, Jha KN, Vemuganti S, Flickinger CJ", "evidence": [ { "database": "RefSeq", "id": "NP_080756", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756" } ], "reference": [ { "type": "PubMed", "id": "18191828", "url": "https://glygen.org/publication/PubMed/18191828" } ] }, { "title": "A subcortical maternal complex essential for preimplantation mouse embryogenesis.", "journal": "Dev. Cell", "date": "2008", "authors": "Li L, Baibakov B, Dean J", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" }, { "database": "RefSeq", "id": "NP_080756", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756" } ], "reference": [ { "type": "PubMed", "id": "18804437", "url": "https://glygen.org/publication/PubMed/18804437" } ] }, { "title": "Maternal-effect gene Ces5/Ooep/Moep19/Floped is essential for oocyte cytoplasmic lattice formation and embryonic development at the maternal-zygotic stage transition.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2010", "authors": "Tashiro F, Kanai-Azuma M, Miyazaki S, Kato M, Tanaka T, Toyoda S, Yamato E, Kawakami H, Miyazaki T, Miyazaki J", "evidence": [ { "database": "RefSeq", "id": "NP_080756", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_080756" } ], "reference": [ { "type": "PubMed", "id": "20590823", "url": "https://glygen.org/publication/PubMed/20590823" } ] }, { "title": "The subcortical maternal complex controls symmetric division of mouse zygotes by regulating F-actin dynamics.", "journal": "Nat. Commun.", "date": "2014", "authors": "Yu XJ, Yi Z, Gao Z, Qin D, Zhai Y, Chen X, Ou-Yang Y, Wang ZB, Zheng P, Zhu MS, Wang H, Sun QY, Dean J, Li L", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "reference": [ { "type": "PubMed", "id": "25208553", "url": "https://glygen.org/publication/PubMed/25208553" } ] }, { "title": "Zbed3 participates in the subcortical maternal complex and regulates the distribution of organelles.", "journal": "J. Mol. Cell Biol.", "date": "2018", "authors": "Gao Z, Zhang X, Yu X, Qin D, Xiao Y, Yu Y, Xiang Y, Nie X, Lu X, Liu W, Yi Z, Li L", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "reference": [ { "type": "PubMed", "id": "28992324", "url": "https://glygen.org/publication/PubMed/28992324" } ] }, { "title": "Mouse embryonic stem cells have increased capacity for replication fork restart driven by the specific Filia-Floped protein complex.", "journal": "Cell Res.", "date": "2018", "authors": "Zhao B, Zhang W, Cun Y, Li J, Liu Y, Gao J, Zhu H, Zhou H, Zhang R, Zheng P", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "reference": [ { "type": "PubMed", "id": "29125140", "url": "https://glygen.org/publication/PubMed/29125140" } ] }, { "title": "Maternal gene Ooep may participate in homologous recombination-mediated DNA double-strand break repair in mouse oocytes.", "journal": "Dong Wu Xue Yan Jiu", "date": "2018", "authors": "He DJ, Wang L, Zhang ZB, Guo K, Li JZ, He XC, Cui QH, Zheng P", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "reference": [ { "type": "PubMed", "id": "29955025", "url": "https://glygen.org/publication/PubMed/29955025" } ] } ], "pathway": [ { "id": "mmu:67968", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:67968", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A6NGQ2-1", "protein_name": "Oocyte-expressed protein homolog", "gene_name": "OOEP", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVDDAGAAESQRGKQTPAHSLEQLRRLPLPPPQIRIRPWWFPVQELRDPLVFYLEAWLADELFGPDRAIIPEMEWTSQALLTVDIVDSGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAHASDPHSPQDPVA", "length": 149 }, "evidence": [ { "id": "45242637", "url": "http://www.informatics.jax.org/homology/45242637", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "positive regulation of meiotic nuclear division", "id": "GO:0045836", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045836", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "establishment of spindle localization", "id": "GO:0051293", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051293", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "in utero embryonic development", "id": "GO:0001701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001701", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "protein phosphorylation", "id": "GO:0006468", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006468", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "actin filament organization", "id": "GO:0007015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007015", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "fertilization", "id": "GO:0009566", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009566", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "regulation of protein localization", "id": "GO:0032880", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032880", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "embryo implantation", "id": "GO:0007566", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007566", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "positive regulation of double-strand break repair", "id": "GO:2000781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000781", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "replication fork processing", "id": "GO:0031297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031297", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "embryonic pattern specification", "id": "GO:0009880", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009880", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "regulation of cell division", "id": "GO:0051302", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051302", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "establishment or maintenance of apical/basal cell polarity", "id": "GO:0035088", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035088", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "regulation of establishment of protein localization", "id": "GO:0070201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070201", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "protein-containing complex assembly", "id": "GO:0065003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0065003", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "positive regulation of double-strand break repair via homologous recombination", "id": "GO:1905168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905168", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "cell cortex", "id": "GO:0005938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005938", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "apical part of cell", "id": "GO:0045177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045177", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" }, { "name": "subcortical maternal complex", "id": "GO:0106333", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106333", "evidence": [ { "database": "UniProtKB", "id": "Q9CWE6", "url": "https://www.uniprot.org/uniprot/Q9CWE6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }