{ "uniprot_canonical_ac": "Q9CW42-1", "uniprot_ac": "Q9CW42", "uniprot_id": "MARC1_MOUSE", "mass": { "chemical_mass": 37979.0, "monoisotopic_mass": 37979.0 }, "refseq": { "ac": "NP_001277202", "name": "mitochondrial amidoxime-reducing component 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277202" }, "gene_names": [ { "name": "Mtarc1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CW42", "id": "Q9CW42" }, { "name": "1300013F15Rik; Marc1; Mosc1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277202", "id": "NP_001277202" }, { "name": "Marc1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9CW42", "id": "Q9CW42" }, { "name": "Mosc1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9CW42", "id": "Q9CW42" }, { "name": "Mtarc1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277202", "id": "NP_001277202" } ], "protein_names": [ { "name": "Mitochondrial amidoxime-reducing component 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CW42" }, { "name": "1.7.-.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CW42" }, { "name": "MOSC domain-containing protein 1, mitochondrial; moco sulfurase C-terminal domain-containing protein 1; molybdenum cofactor sulfurase C-terminal domain-containing protein 1; MOCO sulphurase C-terminal domain containing 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277202", "id": "NP_001277202" }, { "name": "MOSC domain-containing protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CW42" }, { "name": "Moco sulfurase C-terminal domain-containing protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CW42" }, { "name": "Molybdenum cofactor sulfurase C-terminal domain-containing protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CW42" }, { "name": "mARC1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CW42" }, { "name": "mitochondrial amidoxime-reducing component 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277202", "id": "NP_001277202" } ], "function": [ { "annotation": "Catalyzes the reduction of N-oxygenated molecules, acting as a counterpart of cytochrome P450 and flavin-containing monooxygenases in metabolic cycles. As a component of prodrug-converting system, reduces a multitude of N-hydroxylated prodrugs particularly amidoximes, leading to increased drug bioavailability. May be involved in mitochondrial N(omega)-hydroxy-L-arginine (NOHA) reduction, regulating endogenous nitric oxide levels and biosynthesis. Postulated to cleave the N-OH bond of N-hydroxylated substrates in concert with electron transfer from NADH to cytochrome b5 reductase then to cytochrome b5, the ultimate electron donor that primes the active site for substrate reduction.", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42#function" }, { "database": "UniProtKB", "id": "Q5VT66", "url": "https://www.uniprot.org/uniprot/Q5VT66#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mtarc1", "url": "https://www.uniprot.org/uniprot/Q9CW42", "locus": { "chromosome": "1", "start_pos": 184518964, "end_pos": 184543510, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000026621", "url": "https://www.ensembl.org/id/ENSMUSG00000026621" } ] } } ], "crossref": [ { "id": "ENSMUSG00000026621", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000026621", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "66112", "url": "https://www.ncbi.nlm.nih.gov/gene/66112", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR005302", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005302", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005303", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005303", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011037", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011037", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:66112", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66112", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1913362", "url": "http://www.informatics.jax.org/marker/MGI:1913362", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "YPVKGCA", "url": "https://omabrowser.org/oma/group/YPVKGCA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5490564at2759", "url": "http://www.orthodb.org/?query=5490564at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14237", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14237", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14237:SF25", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14237:SF25", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03473", "url": "http://pfam.xfam.org/family/PF03473", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03476", "url": "http://pfam.xfam.org/family/PF03476", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CW42", "url": "http://purl.obolibrary.org/obo/PR_Q9CW42", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-211945", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001277202", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277202", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "61644", "url": "https://www.rhea-db.org/rhea/61644", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A087WPC2", "url": "https://www.uniprot.org/uniprot/A0A087WPC2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WPC2-1", "url": "https://www.uniprot.org/uniprot/A0A087WPC2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YZZ3", "url": "https://www.uniprot.org/uniprot/D3YZZ3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YZZ3-1", "url": "https://www.uniprot.org/uniprot/D3YZZ3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CW42-1", "url": "https://www.uniprot.org/uniprot/Q9CW42-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGAGSWALTLFGFSAFRVPGQPRSTWLGVAALGLAAVALGTVAWRRARPRRRRRLQQVGTVAQLWIYPIKSCKGLSVSEAECTAMGLRYGHLRDRFWLVINEEGNMVTARQEPRLVLISLTCEDDTLTLSAAYTKDLLLPITPPATNPLLQCRVHGLEIQGRDCGEDAAQWVSSFLKMQSCRLVHFEPHMRPRSSRQMKAVFRTKDQVAYSDASPFLVLSEASLEDLNSRLERRVKATNFRPNIVISGCGVYAEDSWNEVLIGDVELKRVMACTRCLLTTVDPDTGISDRKEPLETLKSYRLCDPSEQALYGKLPIFGQYFALENPGTIRVGDPVYLLGQ", "length": 340, "header": "sp|Q9CW42-1|MARC1_MOUSE Isoform 1 of Mitochondrial amidoxime-reducing component 1 OS=Mus musculus OX=10090 GN=Mtarc1 PE=1 SV=2 CANONICAL=Q9CW42-1" }, "isoforms": [ { "isoform_ac": "A0A087WPC2-1", "url": "", "sequence": { "sequence": "MVTARQEPRLVLISLTCEDDTLTLSAAYTKDLLLPITPPATNPLLQCRVHGLEIQGRDCGEDAAQWVSSFLKMQSCRLVHFEPHMRPRSSRQMKAVFRTKDQVAYSDASPFLVLSEASLEDLNSRLERRVKATNFRPNIVISGCGVYAEDSWNEVLIGDVELKRVMACTRCLLTTVDPDTGISDRKEPLETLKSYRLCDPSEQALYGKLPIFGQYFALENPGTIRVGDPVYLLGQ", "length": 235, "header": "tr|A0A087WPC2-1|A0A087WPC2_MOUSE Computationally mapped isoform of Mitochondrial amidoxime reducing component 1 OS=Mus musculus OX=10090 GN=Mtarc1 PE=1 SV=1 CANONICAL=Q9CW42-1" }, "locus": { "chromosome": "1", "start_pos": 184539354, "end_pos": 184519915, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000189492.2", "url": "https://www.ensembl.org/id/ENSMUST00000189492.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000139716.2", "url": "https://www.ensembl.org/id/ENSMUSP00000139716.2" } ] } }, { "isoform_ac": "D3YZZ3-1", "url": "", "sequence": { "sequence": "MGAGSWALTLFGFSAFRVPGQPRSTWLGVAALGLAAVALGTVAWRRARPRRRRRLQQVGTVAQLWIYPIKSCKGLSVSEAECTAMGLRYGHLRDRFWLVINEEGNMVTARQEPRLVLISLTCEDDTLTLSAAYTKDLLLPITPPATNPLLQCRVHGLEIQGRDCGEDAAQWVSSFLKMQSCRLVHFEPHMRPRSSRQMKASGPISQNNEVAYSDASPFLVLSEASLEDLNSRLERRVKATNFRPNIVISGCGVYAEDSWNEVLIGDVELKRVMACTRCLLTTVDPDTGISDRKEPLETLKSYRLCDPSEQALYGKLPIFGQYFALENPGTIRVGDPVYLLGQ", "length": 342, "header": "tr|D3YZZ3-1|MARC1_MOUSE Computationally mapped isoform of Mitochondrial amidoxime-reducing component 1 OS=Mus musculus OX=10090 GN=Mtarc1 PE=1 SV=2 CANONICAL=Q9CW42-1" }, "locus": { "chromosome": "1", "start_pos": 184543326, "end_pos": 184519915, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000110992.9", "url": "https://www.ensembl.org/id/ENSMUST00000110992.9" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000106620.3", "url": "https://www.ensembl.org/id/ENSMUSP00000106620.3" } ] } }, { "isoform_ac": "Q9CW42-1", "url": "", "sequence": { "sequence": "MGAGSWALTLFGFSAFRVPGQPRSTWLGVAALGLAAVALGTVAWRRARPRRRRRLQQVGTVAQLWIYPIKSCKGLSVSEAECTAMGLRYGHLRDRFWLVINEEGNMVTARQEPRLVLISLTCEDDTLTLSAAYTKDLLLPITPPATNPLLQCRVHGLEIQGRDCGEDAAQWVSSFLKMQSCRLVHFEPHMRPRSSRQMKAVFRTKDQVAYSDASPFLVLSEASLEDLNSRLERRVKATNFRPNIVISGCGVYAEDSWNEVLIGDVELKRVMACTRCLLTTVDPDTGISDRKEPLETLKSYRLCDPSEQALYGKLPIFGQYFALENPGTIRVGDPVYLLGQ", "length": 340, "header": "sp|Q9CW42-1|MARC1_MOUSE Isoform 1 of Mitochondrial amidoxime-reducing component 1 OS=Mus musculus OX=10090 GN=Mtarc1 PE=1 SV=2 CANONICAL=Q9CW42-1" }, "locus": { "chromosome": "1", "start_pos": 184543326, "end_pos": 184519915, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000048462", "url": "https://www.ensembl.org/id/ENSMUST00000048462" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000035804", "url": "https://www.ensembl.org/id/ENSMUSP00000035804" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Proteomic analysis of the mouse liver mitochondrial inner membrane.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Da Cruz S, Xenarios I, Langridge J, Vilbois F, Parone PA, Martinou JC", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "reference": [ { "type": "PubMed", "id": "12865426", "url": "https://glygen.org/publication/PubMed/12865426" } ] } ], "pathway": [ { "id": "mmu:66112", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66112", "resource": "KEGG Pathway" }, { "id": "R-MMU-211945", "name": "Phase I - Functionalization of compounds", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-211945", "resource": "Reactome", "description": "Phase I - Functionalization of compounds" } ], "orthologs": [ { "uniprot_canonical_ac": "O88994-1", "protein_name": "Mitochondrial amidoxime reducing component 2", "gene_name": "Mtarc2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGSSSSTALARLGLPGQPRSTWLGVAALGLAAVALGTVAWRRARPRRRRQLQQVGTVSKVWIYPIKSCKGVSVCETECTDMGLRCGKVRDRFWMVVKEDGHMITARQEPRLVLVTITLENNYLMLEAPGMEPIVLPIKLPSSNKIHDCRLFGLDIKGRDCGDEVARWFTSYLKTQAYRLVQFDTKMKGRTTKKLYPSESYLQNYEVAYPDCSPIHLISEASLVDLNTRLQKKVKMEYFRPNIVVSGCEAFEEDTWDELLIGDVEMKRVLSCPRCVLTTVDPDTGIIDRKEPLETLKSYRLCDPSVKSLYQSSPLFGMYFSVEKIGSLRVGDPVYRMVD", "length": 338 }, "evidence": [ { "id": "45239917", "url": "http://www.informatics.jax.org/homology/45239917", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q5VT66-1", "protein_name": "Mitochondrial amidoxime-reducing component 1", "gene_name": "MTARC1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKTPTTNAVHKCRVHGLEIEGRDCGEATAQWITSFLKSQPYRLVHFEPHMRPRRPHQIADLFRPKDQIAYSDTSPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDPDTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ", "length": 337 }, "evidence": [ { "id": "45239917", "url": "http://www.informatics.jax.org/homology/45239917", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "molybdenum ion binding", "id": "GO:0030151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030151", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "nitrate reductase activity", "id": "GO:0008940", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008940", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "pyridoxal phosphate binding", "id": "GO:0030170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030170", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "molybdopterin cofactor binding", "id": "GO:0043546", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043546", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "nitrite reductase (NO-forming) activity", "id": "GO:0050421", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050421", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "catalytic activity", "id": "GO:0003824", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003824", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on other nitrogenous compounds as donors", "id": "GO:0016661", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016661", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "nitrite reductase activity", "id": "GO:0098809", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098809", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "nitric-oxide synthase complex", "id": "GO:1903958", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903958", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "mitochondrial outer membrane", "id": "GO:0005741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "nitric oxide biosynthetic process", "id": "GO:0006809", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006809", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "nitrate metabolic process", "id": "GO:0042126", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042126", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" }, { "name": "cellular detoxification of nitrogen compound", "id": "GO:0070458", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070458", "evidence": [ { "database": "UniProtKB", "id": "Q9CW42", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "61644", "name": "", "equation": "2 Fe(II)-[cytochrome b5] + 2 H(+) + N(omega)-hydroxy-L-arginine = 2 Fe(III)-[cytochrome b5] + H2O + L-arginine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O88994-1", "A0A1W2Q693-1", "Q969Z3-1", "Q5VT66-1", "Q922Q1-1", "Q9CW42-1" ], "evidence": [ { "id": "61644", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/61644" } ] }, { "id": "R-MMU-8936442", "name": "MARC1,MARC2 reduce N-hydroxylated compounds", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, mitochondrial outer membrane", "input_participant_list": [ "R-ALL-8936443" ], "output_participant_list": [], "enzyme_list": [ "Q9DCN2-1", "Q922Q1-1", "Q9CW42-1" ], "evidence": [ { "id": "R-MMU-8936442", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8936442" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-8936443", "participant_name": "NOHA [cytosol]", "crossref": [ { "id": "47823", "database": "ChEBI", "url": "" }, { "id": "5227", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "47823", "database": "ChEBI", "url": "" }, { "id": "5227", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "47823", "database": "ChEBI", "url": "" }, { "id": "5227", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "47823", "database": "ChEBI", "url": "" }, { "id": "5227", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "5227", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "47823", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A1W2Q693", "gene_name": "Mocos", "activity": [ { "ec_number": "2.8.1.9", "activity": "AH2 + L-cysteine + Mo-molybdopterin = A + H2O + L-alanine + thio-Mo-molybdopterin.", "evidence": [ { "id": "A0A1W2Q693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2Q693" } ] }, { "ec_number": "2.8.1.9", "activity": "", "evidence": [ { "id": "A0A1W2Q693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A1W2Q693" } ] } ] }, { "uniprot_ac": "O88994", "gene_name": "Mtarc2", "activity": [ { "ec_number": "1.7.-.-", "activity": "", "evidence": [ { "id": "O88994", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88994" } ] } ] }, { "uniprot_ac": "Q5VT66", "gene_name": "MTARC1", "activity": [ { "ec_number": "1.7.-.-", "activity": "", "evidence": [ { "id": "Q5VT66", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VT66" } ] } ] }, { "uniprot_ac": "Q922Q1", "gene_name": "Mtarc2", "activity": [ { "ec_number": "1.7.-.-", "activity": "", "evidence": [ { "id": "Q922Q1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922Q1" } ] } ] }, { "uniprot_ac": "Q969Z3", "gene_name": "MTARC2", "activity": [ { "ec_number": "1.7.-.-", "activity": "", "evidence": [ { "id": "Q969Z3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q969Z3" } ] } ] }, { "uniprot_ac": "Q9CW42", "gene_name": "Mtarc1", "activity": [ { "ec_number": "1.7.-.-", "activity": "", "evidence": [ { "id": "Q9CW42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CW42" } ] } ] }, { "uniprot_ac": "Q9DCN2", "gene_name": "Cyb5r3", "activity": [ { "ec_number": "1.6.2.2", "activity": "2 Fe(III)-[cytochrome b5] + NADH = 2 Fe(II)-[cytochrome b5] + H(+) + NAD(+).", "evidence": [ { "id": "Q9DCN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCN2" } ] }, { "ec_number": "1.6.2.2", "activity": "", "evidence": [ { "id": "Q9DCN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DCN2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }