{ "uniprot_canonical_ac": "Q9CU24-1", "uniprot_ac": "Q9CU24", "uniprot_id": "THMS3_MOUSE", "mass": { "chemical_mass": 64720.0, "monoisotopic_mass": 64720.0 }, "refseq": { "ac": "NP_083274", "name": "protein THEMIS3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083274" }, "gene_names": [ { "name": "Themis3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CU24", "id": "Q9CU24" }, { "name": "9130404H23Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083274", "id": "NP_083274" }, { "name": "Themis3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083274", "id": "NP_083274" } ], "protein_names": [ { "name": "Protein THEMIS3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CU24" }, { "name": "Thymocyte-expressed molecule involved in selection protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CU24" }, { "name": "protein THEMIS3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083274", "id": "NP_083274" }, { "name": "thymocyte-expressed molecule involved in selection protein 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083274", "id": "NP_083274" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CU24", "url": "https://www.uniprot.org/uniprot/Q9CU24" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Themis3", "url": "https://www.uniprot.org/uniprot/Q9CU24", "locus": { "chromosome": "17", "start_pos": 66861500, "end_pos": 66901616, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000024105", "url": "https://www.ensembl.org/id/ENSMUSG00000024105" } ] } } ], "crossref": [ { "id": "ENSMUSG00000024105", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000024105", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "74556", "url": "https://www.ncbi.nlm.nih.gov/gene/74556", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR025946", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025946", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039671", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039671", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:74556", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:74556", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1921806", "url": "http://www.informatics.jax.org/marker/MGI:1921806", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "MRQIYSM", "url": "https://omabrowser.org/oma/group/MRQIYSM/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5360580at2759", "url": "http://www.orthodb.org/?query=5360580at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15215", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15215", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15215:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15215:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF12736", "url": "http://pfam.xfam.org/family/PF12736", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CU24", "url": "http://purl.obolibrary.org/obo/PR_Q9CU24", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_083274", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083274", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9CU24", "url": "https://www.uniprot.org/uniprot/Q9CU24", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CU24-1", "url": "https://www.uniprot.org/uniprot/Q9CU24-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEQTWDSYISSLNQNSLPRQVEVTQGRYSGSLENLSFSKGDIITVVDLEPVFVRAELKDGDQVLDVVTIPLRYEGNFQLMADPVSFETVADLTRSVRLPQSPVAPRSPPRFQNSIPISADNLPMKLRKGETLSLIGFQESRGRRLLQCKVLRKKPPLTVLLPMDCRGHFLECQDDRFYSIDTIVRWKMLAGRKRTVRVQARHHPKLLGPLVPEHFRGHLVLYPCFSVTANLLGETRVSIPSDLDISVTEIARLDRKPRTTMRQIYSMEESKFPVRVKIMNVVQSESKEYPKPLKRGQLLTILKTEEVKKFVASEISQGKKGKCFLVPYTYQGLVLRRGRYFYAVSDVAAAMKHGELCFQASQDYTSYLGSFASFRANECFLALKKSVVSAEIHGELHRVEVLKCLNIATKAHVKLPLFAVGKFLELFDGARPGTLQELCQVTRLPCHVRVTSPDPSMTVDPLYGTKELRIENVIIEQCLIAKDEPTLEDIISSADMYREWPETTFEIPIEKISCEVLVVEERSWIADVRKERCRPLQSIQEVTKESLAFSNCLVIRRPPPPVPKPRSLF", "length": 569, "header": "sp|Q9CU24-1|THMS3_MOUSE Isoform 1 of Protein THEMIS3 OS=Mus musculus OX=10090 GN=Themis3 PE=2 SV=1 CANONICAL=Q9CU24-1" }, "isoforms": [ { "isoform_ac": "Q9CU24-1", "url": "", "sequence": { "sequence": "MEQTWDSYISSLNQNSLPRQVEVTQGRYSGSLENLSFSKGDIITVVDLEPVFVRAELKDGDQVLDVVTIPLRYEGNFQLMADPVSFETVADLTRSVRLPQSPVAPRSPPRFQNSIPISADNLPMKLRKGETLSLIGFQESRGRRLLQCKVLRKKPPLTVLLPMDCRGHFLECQDDRFYSIDTIVRWKMLAGRKRTVRVQARHHPKLLGPLVPEHFRGHLVLYPCFSVTANLLGETRVSIPSDLDISVTEIARLDRKPRTTMRQIYSMEESKFPVRVKIMNVVQSESKEYPKPLKRGQLLTILKTEEVKKFVASEISQGKKGKCFLVPYTYQGLVLRRGRYFYAVSDVAAAMKHGELCFQASQDYTSYLGSFASFRANECFLALKKSVVSAEIHGELHRVEVLKCLNIATKAHVKLPLFAVGKFLELFDGARPGTLQELCQVTRLPCHVRVTSPDPSMTVDPLYGTKELRIENVIIEQCLIAKDEPTLEDIISSADMYREWPETTFEIPIEKISCEVLVVEERSWIADVRKERCRPLQSIQEVTKESLAFSNCLVIRRPPPPVPKPRSLF", "length": 569, "header": "sp|Q9CU24-1|THMS3_MOUSE Isoform 1 of Protein THEMIS3 OS=Mus musculus OX=10090 GN=Themis3 PE=2 SV=1 CANONICAL=Q9CU24-1" }, "locus": { "chromosome": "17", "start_pos": 66901529, "end_pos": 66862250, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000024914", "url": "https://www.ensembl.org/id/ENSMUST00000024914" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000024914", "url": "https://www.ensembl.org/id/ENSMUSP00000024914" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Themis is a member of a new metazoan gene family and is required for the completion of thymocyte positive selection.", "journal": "Nat. Immunol.", "date": "2009", "authors": "Johnson AL, Aravind L, Shulzhenko N, Morgun A, Choi SY, Crockford TL, Lambe T, Domaschenz H, Kucharska EM, Zheng L, Vinuesa CG, Lenardo MJ, Goodnow CC, Cornall RJ, Schwartz RH", "evidence": [ { "database": "UniProtKB", "id": "Q9CU24", "url": "https://www.uniprot.org/uniprot/Q9CU24" } ], "reference": [ { "type": "PubMed", "id": "19597497", "url": "https://glygen.org/publication/PubMed/19597497" } ] }, { "title": "Themis controls thymocyte selection through regulation of T cell antigen receptor-mediated signaling.", "journal": "Nat. Immunol.", "date": "2009", "authors": "Fu G, Vallee S, Rybakin V, McGuire MV, Ampudia J, Brockmeyer C, Salek M, Fallen PR, Hoerter JA, Munshi A, Huang YH, Hu J, Fox HS, Sauer K, Acuto O, Gascoigne NR", "evidence": [ { "database": "UniProtKB", "id": "Q9CU24", "url": "https://www.uniprot.org/uniprot/Q9CU24" } ], "reference": [ { "type": "PubMed", "id": "19597499", "url": "https://glygen.org/publication/PubMed/19597499" } ] } ], "pathway": [ { "id": "mmu:74556", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:74556", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D4A8M8-1", "protein_name": "Uncharacterized protein", "gene_name": "Themis3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEQTWDSYINSLNRNSLPRQVEVTEGNYFSGSLENLSFSKGDVITVVDLEPILVRAEVKDGERVLDLVDIPLGYEGNFQLVADPVSFETVADLIHSVRLPQNPVAHRSPPRFQNLIPISTDDVPMKLRKGETLSLIGFEESQGRRLLRCEVLRKTPPLKLLLPMDCRGHFLECQDDQLYSIDTIVRWKLLAGRKRRVRVQAGHRLRLLSPLVPEHFRGHLVLHPYFSVMAYLPGETQVSIPSDLDISVTEITGLDRKPRTTMRQIFSMEENKFPVRIKITSVVLTENEVCPKPLKCGQLLTILRTENVRKFVATEISQGKKGRRFLIPYTYQGLVHRRGRYFYAVSDVAAAMQHGQVYFQASRDYTSFLGPSASFEADECFLALKKTVVFAKFHSELHRVKVLKCLNIATKDQVKLPLFAVGEFLELFDGAGPGTLQELCQVTKLPCHVSVASPDPSVTEEEEDPLYGTEELRIENVVVERCLIAKDEPSLEDMIASGDIYRECPEATFAIPIEKSSFEVSVVEEPSWIADVEKEKCTPLQSIQEVTEKSLAFSNCLVIPRPPPLAPKPRSLF", "length": 573 }, "evidence": [ { "id": "45244010", "url": "http://www.informatics.jax.org/homology/45244010", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q9CU24", "url": "https://www.uniprot.org/uniprot/Q9CU24" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9CU24", "url": "https://www.uniprot.org/uniprot/Q9CU24" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "T cell receptor signaling pathway", "id": "GO:0050852", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050852", "evidence": [ { "database": "UniProtKB", "id": "Q9CU24", "url": "https://www.uniprot.org/uniprot/Q9CU24" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 34, "end_pos": 36, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }