{ "uniprot_canonical_ac": "Q9CTY5-1", "uniprot_ac": "Q9CTY5", "uniprot_id": "MICU3_MOUSE", "mass": { "chemical_mass": 59810.0, "monoisotopic_mass": 59810.0 }, "refseq": { "ac": "NP_084386", "name": "calcium uptake protein 3, mitochondrial", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084386" }, "gene_names": [ { "name": "Micu3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CTY5", "id": "Q9CTY5" }, { "name": "2900075B16Rik; Efha2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084386", "id": "NP_084386" }, { "name": "Efha2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9CTY5", "id": "Q9CTY5" }, { "name": "Micu3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084386", "id": "NP_084386" } ], "protein_names": [ { "name": "Calcium uptake protein 3, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CTY5" }, { "name": "EF-hand domain-containing family member A2; EF-hand domain family, member A2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084386", "id": "NP_084386" }, { "name": "EF-hand domain-containing family member A2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CTY5" }, { "name": "calcium uptake protein 3, mitochondrial", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084386", "id": "NP_084386" } ], "function": [ { "annotation": "MICU3 forms a disulfide bond-mediated dimer with MICU1, but not with MICU2, and it acts as enhancer of MCU-dependent mitochondrial Ca(2+) uptake. Silencing of MICU3 in primary cortical neurons impairs Ca(2+) signals elicited by synaptic activity, thus suggesting a specific role in regulating neuronal function. GeneRIF: MICU3 is a tissue-specific enhancer of mitochondrial calcium uptake", "evidence": [ { "database": "RefSeq", "id": "NP_084386", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084386" }, { "database": "PubMed", "id": "29725115", "url": "https://glygen.org/publication/PubMed/29725115" } ] }, { "annotation": "May play a role in mitochondrial calcium uptake.", "evidence": [ { "database": "UniProtKB", "id": "Q9CTY5", "url": "https://www.uniprot.org/uniprot/Q9CTY5#function" } ] }, { "annotation": "Mitochondrial calcium uptake 3 mitigates cerebral amyloid angiopathy-related neuronal death and glial inflammation by reducing mitochondrial dysfunction.", "evidence": [ { "database": "RefSeq", "id": "NP_084386", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084386" }, { "database": "PubMed", "id": "36878048", "url": "https://glygen.org/publication/PubMed/36878048" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CTY5", "url": "https://www.uniprot.org/uniprot/Q9CTY5" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Micu3", "url": "https://www.uniprot.org/uniprot/Q9CTY5", "locus": { "chromosome": "8", "start_pos": 40839349, "end_pos": 40760499, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000039478", "url": "https://www.ensembl.org/id/ENSMUSG00000039478" } ] } } ], "crossref": [ { "id": "ENSMUSG00000039478", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000039478", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16175", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16175", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "78506", "url": "https://www.ncbi.nlm.nih.gov/gene/78506", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9CTY5", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9CTY5*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039800", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039800", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:78506", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:78506", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1925756", "url": "http://www.informatics.jax.org/marker/MGI:1925756", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9CTY5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9CTY5", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "VHFFGPK", "url": "https://omabrowser.org/oma/group/VHFFGPK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1020411at2759", "url": "http://www.orthodb.org/?query=1020411at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12294", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12294", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12294:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12294:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13833", "url": "http://pfam.xfam.org/family/PF13833", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CTY5", "url": "http://purl.obolibrary.org/obo/PR_Q9CTY5", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-8949215", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8949215", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-8949664", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8949664", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_084386", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084386", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F6WMX7", "url": "https://www.uniprot.org/uniprot/F6WMX7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6WMX7-1", "url": "https://www.uniprot.org/uniprot/F6WMX7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CTY5", "url": "https://www.uniprot.org/uniprot/Q9CTY5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CTY5-1", "url": "https://www.uniprot.org/uniprot/Q9CTY5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAALRRFLWPPPRLSPALAPQQPFLSPWGRPAGTAPGMSGRPFSCREEDEGAVAEAAWRRRRWGELSIAAAAGGGLVGLVCYQLYGDPRADPSELAAPELEDPPRGRGLLPIPVAAAKETVATGRAITEDLDLYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKFAKTWKSLSKQELSQMLSETPPVWKGSSKLFRNLKERGVISYTEYLFLLCILTKPHAGFRIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKRETKGDEEKRAMLRLQLYGYHSPTNSVLKTDAGELVSRSYWDTLRRSTSQALFSDLAERADDITSLVADTTLLVHFFGKKGKAELNFEDFYRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSISEEKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKLSPHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR", "length": 523, "header": "sp|Q9CTY5-1|MICU3_MOUSE Isoform 1 of Calcium uptake protein 3, mitochondrial OS=Mus musculus OX=10090 GN=Micu3 PE=2 SV=2 CANONICAL=Q9CTY5-1" }, "isoforms": [ { "isoform_ac": "F6WMX7-1", "url": "", "sequence": { "sequence": "XPHAGFRIAFNMFDTDGNEMVDKKEFLVVLKTDAGELVSRSYWDTLRRSTSQALFSDLAERADDITSLVADTTLLVHFFGKKGKAELNFEDFYRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSISEEKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKLSPHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR", "length": 262, "header": "tr|F6WMX7-1|MICU3_MOUSE Computationally mapped isoform of Calcium uptake protein 3, mitochondrial OS=Mus musculus OX=10090 GN=Micu3 PE=2 SV=1 CANONICAL=Q9CTY5-1" }, "locus": { "chromosome": "8", "start_pos": 40835216, "end_pos": 40807344, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000136835.2", "url": "https://www.ensembl.org/id/ENSMUST00000136835.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000118883.2", "url": "https://www.ensembl.org/id/ENSMUSP00000118883.2" } ] } }, { "isoform_ac": "Q9CTY5-1", "url": "", "sequence": { "sequence": "MAALRRFLWPPPRLSPALAPQQPFLSPWGRPAGTAPGMSGRPFSCREEDEGAVAEAAWRRRRWGELSIAAAAGGGLVGLVCYQLYGDPRADPSELAAPELEDPPRGRGLLPIPVAAAKETVATGRAITEDLDLYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKFAKTWKSLSKQELSQMLSETPPVWKGSSKLFRNLKERGVISYTEYLFLLCILTKPHAGFRIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKRETKGDEEKRAMLRLQLYGYHSPTNSVLKTDAGELVSRSYWDTLRRSTSQALFSDLAERADDITSLVADTTLLVHFFGKKGKAELNFEDFYRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSISEEKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKLSPHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR", "length": 523, "header": "sp|Q9CTY5-1|MICU3_MOUSE Isoform 1 of Calcium uptake protein 3, mitochondrial OS=Mus musculus OX=10090 GN=Micu3 PE=2 SV=2 CANONICAL=Q9CTY5-1" }, "locus": { "chromosome": "8", "start_pos": 40835215, "end_pos": 40761092, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000068999", "url": "https://www.ensembl.org/id/ENSMUST00000068999" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000070241", "url": "https://www.ensembl.org/id/ENSMUSP00000070241" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q9CTY5", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9CTY5" }, { "id": "33300544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33300544" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "MICU2, a paralog of MICU1, resides within the mitochondrial uniporter complex to regulate calcium handling.", "journal": "PLoS ONE", "date": "2013", "authors": "Plovanich M, Bogorad RL, Sancak Y, Kamer KJ, Strittmatter L, Li AA, Girgis HS, Kuchimanchi S, De Groot J, Speciner L, Taneja N, Oshea J, Koteliansky V, Mootha VK", "evidence": [ { "database": "UniProtKB", "id": "Q9CTY5", "url": "https://www.uniprot.org/uniprot/Q9CTY5" } ], "reference": [ { "type": "PubMed", "id": "23409044", "url": "https://glygen.org/publication/PubMed/23409044" } ] }, { "title": "MICU3 is a tissue-specific enhancer of mitochondrial calcium uptake.", "journal": "Cell death and differentiation", "date": "2019", "authors": "Patron M, Granatiero V, Espino J, Rizzuto R, De Stefani D", "evidence": [ { "database": "RefSeq", "id": "NP_084386", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084386" } ], "reference": [ { "type": "PubMed", "id": "29725115", "url": "https://glygen.org/publication/PubMed/29725115" } ] }, { "title": "O-GlcNAcylation regulates dopamine neuron function, survival and degeneration in Parkinson disease.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "Lee BE, Kim HY, Kim HJ, Jeong H, Kim BG, Lee HE, Lee J, Kim HB, Lee SE, Yang YR, Yi EC, Hanover JA, Myung K, Suh PG, Kwon T, Kim JI", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9CTY5", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9CTY5" } ], "reference": [ { "type": "PubMed", "id": "33300544", "url": "https://glygen.org/publication/PubMed/33300544" } ] }, { "title": "Mitochondrial calcium uptake 3 mitigates cerebral amyloid angiopathy-related neuronal death and glial inflammation by reducing mitochondrial dysfunction.", "journal": "International immunopharmacology", "date": "2023-04", "authors": "Zhou Guijuan, Ye Qing, Xu Yan, He Bing, Wu Lin, Zhu Guanghua, Xie Juan, Yao Lan, Xiao Zijian", "evidence": [ { "database": "RefSeq", "id": "NP_084386", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_084386" } ], "reference": [ { "type": "PubMed", "id": "36878048", "url": "https://glygen.org/publication/PubMed/36878048" } ] } ], "pathway": [ { "id": "mmu:78506", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:78506", "resource": "KEGG Pathway" }, { "id": "R-MMU-8949215", "name": "Mitochondrial calcium ion transport", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8949215", "resource": "Reactome", "description": "Mitochondrial calcium ion transport" }, { "id": "R-MMU-8949664", "name": "Processing of SMDT1", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8949664", "resource": "Reactome", "description": "Processing of SMDT1" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6A2H6-1", "protein_name": "Mitochondrial calcium uptake family, member 3", "gene_name": "Micu3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAALRRLLWPPPRLSPTLAPQQPFLSPWGRPAGTAPGMSGRPFSGREEDEGAVAEAAWRRRRWGELSIAAAAGGGLVGLVCYQLYGDPRADPSELVAPELDESPRGRGLLPIPVAAAKETVATGRAVTEDLDLYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKFAKTWKSLSKQELSQMLSETPPVWKGSSKLFRNLKERGVISYTEYLFLLCILTKPHAGFRIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKRETKGDEEKRAMLRLQLYGYHSPTNSVLKPDAEELVSRSYWDTLRRSTSQALFSDLAERADDITSLVADTTLLVHFFGKKGKAELNFEDFYRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPEEKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKLSPHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR", "length": 523 }, "evidence": [ { "id": "45229076", "url": "http://www.informatics.jax.org/homology/45229076", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q86XE3-1", "protein_name": "Calcium uptake protein 3, mitochondrial", "gene_name": "MICU3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAALRRLLWPPPRVSPPLCAHQPLLGPWGRPAVTTLGLPGRPFSSREDEERAVAEAAWRRRRRWGELSVAAAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDPPRGRGMLPIPVAAAKETVAIGRTDIEDLDLYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKVAKTWKSLSKQELNQMLAETPPVWKGSSKLFRNLKEKGVISYTEYLFLLCILTKPHAGFRIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKTDAEELVSRSYWDTLRRNTSQALFSDLAERADDITSLVTDTTLLVHFFGKKGKAELNFEDFYRFMDNLQTEVLEIEFLSYSNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSIPEEKGITFDEFRSFFQFLNNLEDFAIALNMYNFASRSIGQDEFKRAVYVATGLKFSPHLVNTVFKIFDVDKDDQLSYKEFIGIMKDRLHRGFRGYKTVQKYPTFKSCLKKELHSR", "length": 530 }, "evidence": [ { "id": "45229076", "url": "http://www.informatics.jax.org/homology/45229076", "database": "MGI" }, { "id": "Q9CTY5", "url": "https://omabrowser.org/oma/group/Q9CTY5/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "Q9CTY5", "url": "https://www.uniprot.org/uniprot/Q9CTY5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "mitochondrial calcium ion transmembrane transport", "id": "GO:0006851", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006851", "evidence": [ { "database": "UniProtKB", "id": "Q9CTY5", "url": "https://www.uniprot.org/uniprot/Q9CTY5" } ], "pmid": "" }, { "name": "calcium import into the mitochondrion", "id": "GO:0036444", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036444", "evidence": [ { "database": "UniProtKB", "id": "Q9CTY5", "url": "https://www.uniprot.org/uniprot/Q9CTY5" } ], "pmid": "" }, { "name": "mitochondrial calcium ion homeostasis", "id": "GO:0051560", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051560", "evidence": [ { "database": "UniProtKB", "id": "Q9CTY5", "url": "https://www.uniprot.org/uniprot/Q9CTY5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "uniplex complex", "id": "GO:1990246", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990246", "evidence": [ { "database": "UniProtKB", "id": "Q9CTY5", "url": "https://www.uniprot.org/uniprot/Q9CTY5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 396, "end_pos": 398, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }