{ "uniprot_canonical_ac": "Q9CR30-1", "uniprot_ac": "Q9CR30", "uniprot_id": "JOS2_MOUSE", "mass": { "chemical_mass": 20776.0, "monoisotopic_mass": 20776.0 }, "refseq": { "ac": "NP_001191999", "name": "josephin-2 isoform a", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191999" }, "gene_names": [ { "name": "Josd2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CR30", "id": "Q9CR30" }, { "name": "1110007C05Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191999", "id": "NP_001191999" }, { "name": "Josd2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191999", "id": "NP_001191999" } ], "protein_names": [ { "name": "Josephin-2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CR30" }, { "name": "3.4.19.12", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CR30" }, { "name": "Josephin domain-containing protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CR30" }, { "name": "josephin-2 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191999", "id": "NP_001191999" }, { "name": "josephin-2; josephin domain-containing protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191999", "id": "NP_001191999" } ], "function": [ { "annotation": "Cleaves 'Lys-63'-linked poly-ubiquitin chains, and with lesser efficiency 'Lys-48'-linked poly-ubiquitin chains (in vitro). May act as a deubiquitinating enzyme (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9CR30", "url": "https://www.uniprot.org/uniprot/Q9CR30#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CR30", "url": "https://www.uniprot.org/uniprot/Q9CR30" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Josd2", "url": "https://www.uniprot.org/uniprot/Q9CR30", "locus": { "chromosome": "7", "start_pos": 44121086, "end_pos": 44117404, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000038695", "url": "https://www.ensembl.org/id/ENSMUSG00000038695" } ] } } ], "crossref": [ { "id": "ENSMUSG00000038695", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000038695", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "66124", "url": "https://www.ncbi.nlm.nih.gov/gene/66124", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006155", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006155", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040053", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040053", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:66124", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66124", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1913374", "url": "http://www.informatics.jax.org/marker/MGI:1913374", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "HERQTRH", "url": "https://omabrowser.org/oma/group/HERQTRH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "239839at2759", "url": "http://www.orthodb.org/?query=239839at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13291", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13291", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13291:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13291:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02099", "url": "http://pfam.xfam.org/family/PF02099", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CR30", "url": "http://purl.obolibrary.org/obo/PR_Q9CR30", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-5689877", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5689877", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001191999", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191999", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0U1RNI9", "url": "https://www.uniprot.org/uniprot/A0A0U1RNI9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RNI9-1", "url": "https://www.uniprot.org/uniprot/A0A0U1RNI9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RP71", "url": "https://www.uniprot.org/uniprot/A0A0U1RP71", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0U1RP71-1", "url": "https://www.uniprot.org/uniprot/A0A0U1RP71-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LIJ7", "url": "https://www.uniprot.org/uniprot/A0A140LIJ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LIJ7-1", "url": "https://www.uniprot.org/uniprot/A0A140LIJ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LJD5", "url": "https://www.uniprot.org/uniprot/A0A140LJD5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A140LJD5-1", "url": "https://www.uniprot.org/uniprot/A0A140LJD5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YTZ7", "url": "https://www.uniprot.org/uniprot/D3YTZ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D3YTZ7-1", "url": "https://www.uniprot.org/uniprot/D3YTZ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RDE6", "url": "https://www.uniprot.org/uniprot/D6RDE6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RDE6-1", "url": "https://www.uniprot.org/uniprot/D6RDE6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8VCY7", "url": "https://www.uniprot.org/uniprot/Q8VCY7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8VCY7-1", "url": "https://www.uniprot.org/uniprot/Q8VCY7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CR30", "url": "https://www.uniprot.org/uniprot/Q9CR30", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CR30-1", "url": "https://www.uniprot.org/uniprot/Q9CR30-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSQAPEARPSPPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGIYYNLDSKLRAPEALGDEDGVRTFLAAALAQGLCEVLLVVTKEVEEAGCWLNTS", "length": 188, "header": "sp|Q9CR30-1|JOS2_MOUSE Isoform 1 of Josephin-2 OS=Mus musculus OX=10090 GN=Josd2 PE=1 SV=1 CANONICAL=Q9CR30-1" }, "isoforms": [ { "isoform_ac": "A0A0U1RNI9-1", "url": "", "sequence": { "sequence": "MSQAPEARPSPPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRTFLAAALAQGLCEVLLVVTKEVEEAGCWLNTS", "length": 123, "header": "tr|A0A0U1RNI9-1|A0A0U1RNI9_MOUSE Computationally mapped isoform of ubiquitinyl hydrolase 1 OS=Mus musculus OX=10090 GN=Josd2 PE=1 SV=1 CANONICAL=Q9CR30-1" }, "locus": { "chromosome": "7", "start_pos": 44120935, "end_pos": 44118248, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000206887.2", "url": "https://www.ensembl.org/id/ENSMUST00000206887.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000145582.2", "url": "https://www.ensembl.org/id/ENSMUSP00000145582.2" } ] } }, { "isoform_ac": "A0A0U1RP71-1", "url": "", "sequence": { "sequence": "MSQAPEARPSPPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRTFLAAALAQGLCEVLLVVTKEVEEAGCWLNTS", "length": 81, "header": "tr|A0A0U1RP71-1|JOS2_MOUSE Computationally mapped isoform of Josephin-2 OS=Mus musculus OX=10090 GN=Josd2 PE=1 SV=1 CANONICAL=Q9CR30-1" }, "locus": { "chromosome": "7", "start_pos": 44120935, "end_pos": 44118248, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000134398.3", "url": "https://www.ensembl.org/id/ENSMUST00000134398.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000145857.2", "url": "https://www.ensembl.org/id/ENSMUSP00000145857.2" } ] } }, { "isoform_ac": "A0A140LIJ7-1", "url": "", "sequence": { "sequence": "MSQAPEARPSPPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRLAPDSRLNPHRSLLGTGN", "length": 67, "header": "tr|A0A140LIJ7-1|A0A140LIJ7_MOUSE Computationally mapped isoform of ubiquitinyl hydrolase 1 OS=Mus musculus OX=10090 GN=Josd2 PE=1 SV=1 CANONICAL=Q9CR30-1" }, "locus": { "chromosome": "7", "start_pos": 44119890, "end_pos": 44118248, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000208117.2", "url": "https://www.ensembl.org/id/ENSMUST00000208117.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000146846.2", "url": "https://www.ensembl.org/id/ENSMUSP00000146846.2" } ] } }, { "isoform_ac": "A0A140LJD5-1", "url": "", "sequence": { "sequence": "XSQAPEARPSPPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRRLPRHI", "length": 97, "header": "tr|A0A140LJD5-1|A0A140LJD5_MOUSE Computationally mapped isoform of ubiquitinyl hydrolase 1 OS=Mus musculus OX=10090 GN=Josd2 PE=1 SV=1 CANONICAL=Q9CR30-1" }, "locus": { "chromosome": "7", "start_pos": 44120303, "end_pos": 44118250, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000139097.2", "url": "https://www.ensembl.org/id/ENSMUST00000139097.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000147171.2", "url": "https://www.ensembl.org/id/ENSMUSP00000147171.2" } ] } }, { "isoform_ac": "D3YTZ7-1", "url": "", "sequence": { "sequence": "MSQAPEARPSPPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGIYYNLDSKLRAPEALGDEDGVRTFLAAALAQGLCEVLLVVTKEVEEAGCWLNTS", "length": 146, "header": "tr|D3YTZ7-1|JOS2_MOUSE Computationally mapped isoform of Josephin-2 OS=Mus musculus OX=10090 GN=Josd2 PE=1 SV=1 CANONICAL=Q9CR30-1" }, "locus": { "chromosome": "7", "start_pos": 44120935, "end_pos": 44118248, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000121922.3", "url": "https://www.ensembl.org/id/ENSMUST00000121922.3" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000112796.2", "url": "https://www.ensembl.org/id/ENSMUSP00000112796.2" } ] } }, { "isoform_ac": "D6RDE6-1", "url": "", "sequence": { "sequence": "MSQAPEARPSPPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRDSEHSLGSEGSSPRRNDI", "length": 67, "header": "tr|D6RDE6-1|JOS2_MOUSE Computationally mapped isoform of Josephin-2 OS=Mus musculus OX=10090 GN=Josd2 PE=1 SV=1 CANONICAL=Q9CR30-1" }, "locus": { "chromosome": "7", "start_pos": 44119461, "end_pos": 44118248, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000136679.8", "url": "https://www.ensembl.org/id/ENSMUST00000136679.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114900.2", "url": "https://www.ensembl.org/id/ENSMUSP00000114900.2" } ] } }, { "isoform_ac": "Q8VCY7-1", "url": "", "sequence": { "sequence": "MSQAPEARPSPPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRRLPRHI", "length": 97, "header": "tr|Q8VCY7-1|Q8VCY7_MOUSE Computationally mapped isoform of ubiquitinyl hydrolase 1 OS=Mus musculus OX=10090 GN=Josd2 PE=1 SV=1 CANONICAL=Q9CR30-1" }, "locus": { "chromosome": "7", "start_pos": 44120301, "end_pos": 44118248, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000136609.8", "url": "https://www.ensembl.org/id/ENSMUST00000136609.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000123205.2", "url": "https://www.ensembl.org/id/ENSMUSP00000123205.2" } ] } }, { "isoform_ac": "Q9CR30-1", "url": "", "sequence": { "sequence": "MSQAPEARPSPPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGIYYNLDSKLRAPEALGDEDGVRTFLAAALAQGLCEVLLVVTKEVEEAGCWLNTS", "length": 188, "header": "sp|Q9CR30-1|JOS2_MOUSE Isoform 1 of Josephin-2 OS=Mus musculus OX=10090 GN=Josd2 PE=1 SV=1 CANONICAL=Q9CR30-1" }, "locus": { "chromosome": "7", "start_pos": 44120935, "end_pos": 44118248, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000120852", "url": "https://www.ensembl.org/id/ENSMUST00000120852" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000114105", "url": "https://www.ensembl.org/id/ENSMUSP00000114105" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Structural modeling of ataxin-3 reveals distant homology to adaptins.", "journal": "Proteins", "date": "2003", "authors": "Wuellner U., Albrecht M., Lengauer T., Evert B.O., Hoffmann D., Schmitt I.", "evidence": [ { "database": "UniProtKB", "id": "Q9CR30", "url": "https://www.uniprot.org/uniprot/Q9CR30" } ], "reference": [ { "type": "PubMed", "id": "12486728", "url": "https://glygen.org/publication/PubMed/12486728" } ] } ], "pathway": [ { "id": "mmu:66124", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66124", "resource": "KEGG Pathway" }, { "id": "R-MMU-5689877", "name": "Josephin domain DUBs", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5689877", "resource": "Reactome", "description": "Josephin domain DUBs" } ], "orthologs": [ { "uniprot_canonical_ac": "D4AD44-1", "protein_name": "ubiquitinyl hydrolase 1", "gene_name": "Josd2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRKRPVPGSGKAGGATRRDPVTQRRERRSPPLLAGAEEGMSQAPEARPRSPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLVLPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGIYYNLDSKLRAPEALGGEDGVRAFLAAALAQGLCEVLLVVTKEVEEAGCWLHTS", "length": 227 }, "evidence": [ { "id": "45237136", "url": "http://www.informatics.jax.org/homology/45237136", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8TAC2-1", "protein_name": "Josephin-2", "gene_name": "JOSD2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGSWLRTD", "length": 188 }, "evidence": [ { "id": "45237136", "url": "http://www.informatics.jax.org/homology/45237136", "database": "MGI" }, { "id": "Q9CR30", "url": "https://omabrowser.org/oma/group/Q9CR30/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9W422-1", "protein_name": "Josephin-like protein", "gene_name": "Josd", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MESPSARTLGNSLGDDSGNGNENGNGSGNGNTTMMPHGIYHERQTRHLCGLHALNNLFQGPDMFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIMYALQQRNCEAVWFDRRRDPHCLNLSVIFGFILNVPAQMSLGYYIPLPFHMRHWLALRRLNGSYYNLDSKLREPKCLGTEQQFLEFLATQLQMDHELFLVLDEETDCKDKSQQRWLLPQFRD", "length": 221 }, "evidence": [ { "id": "Q9CR30", "url": "https://omabrowser.org/oma/group/Q9CR30/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "protein deubiquitination", "id": "GO:0016579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016579", "evidence": [ { "database": "UniProtKB", "id": "Q9CR30", "url": "https://www.uniprot.org/uniprot/Q9CR30" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cysteine-type deubiquitinase activity", "id": "GO:0004843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004843", "evidence": [ { "database": "UniProtKB", "id": "Q9CR30", "url": "https://www.uniprot.org/uniprot/Q9CR30" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9CR30", "url": "https://www.uniprot.org/uniprot/Q9CR30" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9CR30", "url": "https://www.uniprot.org/uniprot/Q9CR30" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 186, "end_pos": 188, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-MMU-5688797", "name": "ATXN3 family cleave Ub chains", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9CVD2-1", "Q9CR30-1", "Q9DBJ6-1" ], "evidence": [ { "id": "R-MMU-5688797", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-5688797" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "Q9CR30", "gene_name": "Josd2", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "Q9CR30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CR30" } ] }, { "ec_number": "3.4.19.12", "activity": "", "evidence": [ { "id": "Q9CR30", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CR30" } ] } ] }, { "uniprot_ac": "Q9CVD2", "gene_name": "Atxn3", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "Q9CVD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CVD2" } ] }, { "ec_number": "3.4.19.12", "activity": "", "evidence": [ { "id": "Q9CVD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CVD2" } ] } ] }, { "uniprot_ac": "Q9DBJ6", "gene_name": "Josd1", "activity": [ { "ec_number": "3.4.19.12", "activity": "Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).", "evidence": [ { "id": "Q9DBJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBJ6" } ] }, { "ec_number": "3.4.19.12", "activity": "", "evidence": [ { "id": "Q9DBJ6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBJ6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }