{ "uniprot_canonical_ac": "Q9CR26-1", "uniprot_ac": "Q9CR26", "uniprot_id": "VTA1_MOUSE", "mass": { "chemical_mass": 33913.0, "monoisotopic_mass": 33913.0 }, "refseq": { "ac": "NP_079694", "name": "vacuolar protein sorting-associated protein VTA1 homolog", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079694" }, "gene_names": [ { "name": "Vta1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CR26", "id": "Q9CR26" }, { "name": "1110001D18Rik; 1110059P08Rik; LIP5; SBP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079694", "id": "NP_079694" }, { "name": "Vta1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079694", "id": "NP_079694" } ], "protein_names": [ { "name": "Vacuolar protein sorting-associated protein VTA1 homolog", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CR26" }, { "name": "SBP1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CR26" }, { "name": "SKD1-binding protein 1; lysosomal trafficking regulator interacting protein-5; Vps20-associated 1 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079694", "id": "NP_079694" }, { "name": "SKD1-binding protein 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CR26" }, { "name": "vacuolar protein sorting-associated protein VTA1 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079694", "id": "NP_079694" } ], "function": [ { "annotation": "Involved in the endosomal multivesicular bodies (MVB) pathway. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. Thought to be a cofactor of VPS4A/B, which catalyzes disassembles membrane-associated ESCRT-III assemblies (By similarity). Involved in the sorting and down-regulation of EGFR.", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26#function" }, { "database": "PubMed", "id": "15173323", "url": "https://glygen.org/publication/PubMed/15173323" } ] }, { "annotation": "LIP5 protein expression in a mouse tissue panel and various rodent and human tissues were studied.[LIP5]", "evidence": [ { "database": "RefSeq", "id": "NP_079694", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079694" }, { "database": "PubMed", "id": "20358264", "url": "https://glygen.org/publication/PubMed/20358264" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Vta1", "url": "https://www.uniprot.org/uniprot/Q9CR26", "locus": { "chromosome": "10", "start_pos": 14530499, "end_pos": 14581304, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000019868", "url": "https://www.ensembl.org/id/ENSMUSG00000019868" } ] } } ], "crossref": [ { "id": "ENSMUSG00000019868", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000019868", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "66201", "url": "https://www.ncbi.nlm.nih.gov/gene/66201", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9CR26", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9CR26*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR023175", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023175", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039431", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039431", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041212", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041212", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044538", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044538", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:66201", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66201", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1913451", "url": "http://www.informatics.jax.org/marker/MGI:1913451", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "TMRANKV", "url": "https://omabrowser.org/oma/group/TMRANKV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5491267at2759", "url": "http://www.orthodb.org/?query=5491267at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46009", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46009", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46009:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46009:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04652", "url": "http://pfam.xfam.org/family/PF04652", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18097", "url": "http://pfam.xfam.org/family/PF18097", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CR26", "url": "http://purl.obolibrary.org/obo/PR_Q9CR26", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-917729", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-917729", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_079694", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079694", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F6RYM7", "url": "https://www.uniprot.org/uniprot/F6RYM7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RYM7-1", "url": "https://www.uniprot.org/uniprot/F6RYM7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6W5Q8", "url": "https://www.uniprot.org/uniprot/F6W5Q8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6W5Q8-1", "url": "https://www.uniprot.org/uniprot/F6W5Q8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WJC2", "url": "https://www.uniprot.org/uniprot/F8WJC2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WJC2-1", "url": "https://www.uniprot.org/uniprot/F8WJC2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CR26-1", "url": "https://www.uniprot.org/uniprot/Q9CR26-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAVTQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEENDVEENEDVGATSLPTQPPQPSSSSAYDPSNLAPGSYSGIQIPPGAHAPANTPAEVPHSTGVTSNAVQPSPQTVPAAPAVDPDLYTASQGDIRLTPEDFARAQKYCKYAGSALQYEDVGTAVQNLQKALRLLTTGRE", "length": 309, "header": "sp|Q9CR26-1|VTA1_MOUSE Isoform 1 of Vacuolar protein sorting-associated protein VTA1 homolog OS=Mus musculus OX=10090 GN=Vta1 PE=1 SV=1 CANONICAL=Q9CR26-1" }, "isoforms": [ { "isoform_ac": "F6RYM7-1", "url": "", "sequence": { "sequence": "ITVFGELTDEMLKKMKMLAQPLCPLSHLSHHHLQHTTQATWHQAATVAYRFLQVHMLQLIPLQKCHTAQV", "length": 70, "header": "tr|F6RYM7-1|F6RYM7_MOUSE Computationally mapped isoform of Vesicle (multivesicular body) trafficking 1 OS=Mus musculus OX=10090 GN=Vta1 PE=4 SV=1 CANONICAL=Q9CR26-1" }, "locus": { "chromosome": "10", "start_pos": 14559837, "end_pos": 14536894, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000133927.2", "url": "https://www.ensembl.org/id/ENSMUST00000133927.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000119958.2", "url": "https://www.ensembl.org/id/ENSMUSP00000119958.2" } ] } }, { "isoform_ac": "F6W5Q8-1", "url": "", "sequence": { "sequence": "XAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAVTQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEENDVEENEDVGATSLPTQPPQPSSSSAYDPSNLAPGSYSGIQIPPGAHAPANTPAEVPHSTGDIRLTPEDFARAQKYCKY", "length": 251, "header": "tr|F6W5Q8-1|F6W5Q8_MOUSE Computationally mapped isoform of Vesicle (multivesicular body) trafficking 1 OS=Mus musculus OX=10090 GN=Vta1 PE=1 SV=8 CANONICAL=Q9CR26-1" }, "locus": { "chromosome": "10", "start_pos": 14581203, "end_pos": 14531532, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000149485.2", "url": "https://www.ensembl.org/id/ENSMUST00000149485.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000118498.2", "url": "https://www.ensembl.org/id/ENSMUSP00000118498.2" } ] } }, { "isoform_ac": "F8WJC2-1", "url": "", "sequence": { "sequence": "MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYS", "length": 38, "header": "tr|F8WJC2-1|F8WJC2_MOUSE Computationally mapped isoform of Vesicle (multivesicular body) trafficking 1 OS=Mus musculus OX=10090 GN=Vta1 PE=1 SV=1 CANONICAL=Q9CR26-1" }, "locus": { "chromosome": "10", "start_pos": 14581205, "end_pos": 14560751, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000020018.12", "url": "https://www.ensembl.org/id/ENSMUST00000020018.12" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000020018.6", "url": "https://www.ensembl.org/id/ENSMUSP00000020018.6" } ] } }, { "isoform_ac": "Q9CR26-1", "url": "", "sequence": { "sequence": "MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAVTQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEENDVEENEDVGATSLPTQPPQPSSSSAYDPSNLAPGSYSGIQIPPGAHAPANTPAEVPHSTGVTSNAVQPSPQTVPAAPAVDPDLYTASQGDIRLTPEDFARAQKYCKYAGSALQYEDVGTAVQNLQKALRLLTTGRE", "length": 309, "header": "sp|Q9CR26-1|VTA1_MOUSE Isoform 1 of Vacuolar protein sorting-associated protein VTA1 homolog OS=Mus musculus OX=10090 GN=Vta1 PE=1 SV=1 CANONICAL=Q9CR26-1" }, "locus": { "chromosome": "10", "start_pos": 14581205, "end_pos": 14531447, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000154132", "url": "https://www.ensembl.org/id/ENSMUST00000154132" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000119829", "url": "https://www.ensembl.org/id/ENSMUSP00000119829" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Mammalian class E Vps proteins, SBP1 and mVps2/CHMP2A, interact with and regulate the function of an AAA-ATPase SKD1/Vps4B.", "journal": "J. Cell Sci.", "date": "2004", "authors": "Fujita H, Umezuki Y, Imamura K, Ishikawa D, Uchimura S, Nara A, Yoshimori T, Hayashizaki Y, Kawai J, Ishidoh K, Tanaka Y, Himeno M", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "reference": [ { "type": "PubMed", "id": "15173323", "url": "https://glygen.org/publication/PubMed/15173323" } ] }, { "title": "The lysosomal trafficking regulator interacting protein-5 localizes mainly in epithelial cells.", "journal": "Journal of molecular histology", "date": "2010", "authors": "Boone M, Mobasheri A, Fenton RA, van Balkom BW, Wismans R, van der Zee CE, Deen PM", "evidence": [ { "database": "RefSeq", "id": "NP_079694", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079694" } ], "reference": [ { "type": "PubMed", "id": "20358264", "url": "https://glygen.org/publication/PubMed/20358264" } ] } ], "pathway": [ { "id": "mmu:66201", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66201", "resource": "KEGG Pathway" }, { "id": "R-MMU-917729", "name": "Endosomal Sorting Complex Required For Transport (ESCRT)", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-917729", "resource": "Reactome", "description": "Endosomal Sorting Complex Required For Transport (ESCRT)" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6A5Y0-1", "protein_name": "Vesicle trafficking 1", "gene_name": "Vta1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAVTQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDVEENEDVGATSLPTQPPQPSSSSTYDPSNLAAGSYSGIQIPPGAHAPANTPAEVPHSTGVTSNAVQPSPQTVPAIPAIDPDLYTASQGDVRLTPEDFARAQKYCKYAGSALQYEDVSTAVQNLQKALRLLTTGRE", "length": 309 }, "evidence": [ { "id": "45232395", "url": "http://www.informatics.jax.org/homology/45232395", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9NP79-1", "protein_name": "Vacuolar protein sorting-associated protein VTA1 homolog", "gene_name": "VTA1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYTGIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAGSALQYEDVSTAVQNLQKALKLLTTGRE", "length": 307 }, "evidence": [ { "id": "45232395", "url": "http://www.informatics.jax.org/homology/45232395", "database": "MGI" }, { "id": "Q9CR26", "url": "https://omabrowser.org/oma/group/Q9CR26/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "multivesicular body sorting pathway", "id": "GO:0071985", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071985", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "pmid": "" }, { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "pmid": "" }, { "name": "late endosome to vacuole transport via multivesicular body sorting pathway", "id": "GO:0032511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032511", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "pmid": "" }, { "name": "multivesicular body", "id": "GO:0005771", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005771", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9CR26", "url": "https://www.uniprot.org/uniprot/Q9CR26" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }