{ "uniprot_canonical_ac": "Q9CQG1-1", "uniprot_ac": "Q9CQG1", "uniprot_id": "CHAC2_MOUSE", "mass": { "chemical_mass": 20153.0, "monoisotopic_mass": 20153.0 }, "refseq": { "ac": "NP_001277596", "name": "putative glutathione-specific gamma-glutamylcyclotransferase 2 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277596" }, "gene_names": [ { "name": "Chac2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CQG1", "id": "Q9CQG1" }, { "name": "Chac2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277596", "id": "NP_001277596" } ], "protein_names": [ { "name": "Putative glutathione-specific gamma-glutamylcyclotransferase 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CQG1" }, { "name": "4.3.2.7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CQG1" }, { "name": "Cation transport regulator-like protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CQG1" }, { "name": "Gamma-GCG 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CQG1" }, { "name": "cation transport regulator-like protein 2; ChaC, cation transport regulator homolog 2; gamma-GCG 2; putative glutathione-specific gamma-glutamylcyclotransferase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277596", "id": "NP_001277596" }, { "name": "putative glutathione-specific gamma-glutamylcyclotransferase 2 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277596", "id": "NP_001277596" } ], "function": [ { "annotation": "Catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide (PubMed:27913623). Acts specifically on glutathione, but not on other gamma-glutamyl peptides (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q9CQG1", "url": "https://www.uniprot.org/uniprot/Q9CQG1#function" }, { "database": "UniProtKB", "id": "Q8WUX2", "url": "https://www.uniprot.org/uniprot/Q8WUX2#function" }, { "database": "PubMed", "id": "27913623", "url": "https://glygen.org/publication/PubMed/27913623" } ] }, { "annotation": "Human and mouse ChaC2 proteins purified in vitro show 10-20-fold lower catalytic efficiency than ChaC1, although they showed comparable Km values", "evidence": [ { "database": "RefSeq", "id": "NP_001277596", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277596" }, { "database": "PubMed", "id": "27913623", "url": "https://glygen.org/publication/PubMed/27913623" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CQG1", "url": "https://www.uniprot.org/uniprot/Q9CQG1" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Chac2", "url": "https://www.uniprot.org/uniprot/Q9CQG1", "locus": { "chromosome": "11", "start_pos": 30926707, "end_pos": 30936350, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000020309", "url": "https://www.ensembl.org/id/ENSMUSG00000020309" } ] } } ], "crossref": [ { "id": "ENSMUSG00000020309", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000020309", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "4.3.2.7", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=4.3.2.7&UniProtAcc=Q9CQG1", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd06661", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06661", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "68044", "url": "https://www.ncbi.nlm.nih.gov/gene/68044", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006840", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006840", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036568", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036568", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:68044", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:68044", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1915294", "url": "http://www.informatics.jax.org/marker/MGI:1915294", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "PGYINGY", "url": "https://omabrowser.org/oma/group/PGYINGY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "662654at2759", "url": "http://www.orthodb.org/?query=662654at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12192", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12192", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12192:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12192:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04752", "url": "http://pfam.xfam.org/family/PF04752", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CQG1", "url": "http://purl.obolibrary.org/obo/PR_Q9CQG1", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-174403", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174403", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001277596", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277596", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "47724", "url": "https://www.rhea-db.org/rhea/47724", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q9CQG1", "url": "https://www.uniprot.org/uniprot/Q9CQG1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CQG1-1", "url": "https://www.uniprot.org/uniprot/Q9CQG1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CQG1-2", "url": "https://www.uniprot.org/uniprot/Q9CQG1-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPGGSVWGVAYKLPVGKEEEVKTYLDFREKGGYRTTTVIFYPKDSTTKPFSVLLYIGTCDNPNYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELADSVRKLVPEDADEHLFSLEKLVKERLEGK", "length": 178, "header": "sp|Q9CQG1-1|CHAC2_MOUSE Isoform 1 of Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Mus musculus OX=10090 GN=Chac2 PE=1 SV=1 CANONICAL=Q9CQG1-1" }, "isoforms": [ { "isoform_ac": "Q9CQG1-1", "url": "", "sequence": { "sequence": "MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPGGSVWGVAYKLPVGKEEEVKTYLDFREKGGYRTTTVIFYPKDSTTKPFSVLLYIGTCDNPNYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELADSVRKLVPEDADEHLFSLEKLVKERLEGK", "length": 178, "header": "sp|Q9CQG1-1|CHAC2_MOUSE Isoform 1 of Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Mus musculus OX=10090 GN=Chac2 PE=1 SV=1 CANONICAL=Q9CQG1-1" }, "locus": { "chromosome": "11", "start_pos": 30936246, "end_pos": 30927384, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000101394", "url": "https://www.ensembl.org/id/ENSMUST00000101394" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000098942", "url": "https://www.ensembl.org/id/ENSMUSP00000098942" } ] } }, { "isoform_ac": "Q9CQG1-2", "url": "", "sequence": { "sequence": "MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKGSVWGVAYKLPVGKEEEVKTYLDFREKGGYRTTTVIFYPKDSTTKPFSVLLYIGTCDNPNYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELADSVRKLVPEDADEHLFSLEKLVKERLEGK", "length": 166, "header": "sp|Q9CQG1-2|CHAC2_MOUSE Isoform 2 of Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Mus musculus OX=10090 GN=Chac2 PE=1 SV=1 CANONICAL=Q9CQG1-1" }, "locus": { "chromosome": "11", "start_pos": 30936246, "end_pos": 30927384, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000020553", "url": "https://www.ensembl.org/id/ENSMUST00000020553" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000020553", "url": "https://www.ensembl.org/id/ENSMUSP00000020553" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "ChaC2, an enzyme for slow turnover of cytosolic glutathione.", "journal": "J. Biol. Chem.", "date": "2017", "authors": "Kaur A, Gautam R, Srivastava R, Chandel A, Kumar A, Karthikeyan S, Bachhawat AK", "evidence": [ { "database": "UniProtKB", "id": "Q9CQG1", "url": "https://www.uniprot.org/uniprot/Q9CQG1" }, { "database": "RefSeq", "id": "NP_001277596", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277596" } ], "reference": [ { "type": "PubMed", "id": "27913623", "url": "https://glygen.org/publication/PubMed/27913623" } ] } ], "pathway": [ { "id": "mmu:68044", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:68044", "resource": "KEGG Pathway" }, { "id": "R-MMU-174403", "name": "Glutathione synthesis and recycling", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-174403", "resource": "Reactome", "description": "Glutathione synthesis and recycling" } ], "orthologs": [ { "uniprot_canonical_ac": "P32656-1", "protein_name": "Glutathione-specific gamma-glutamylcyclotransferase", "gene_name": "GCG1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MTNDNSGIWVLGYGSLIYKPPSHYTHRIPAIIHGFARRFWQSSTDHRGTPANPGRVATLIPYEDIIRQTAFLKNVNLYSESAPIQDPDDLVTIGVVYYIPPEHAQEVREYLNVREQNGYTLHEVEVHLETNREHEAELGEALEQLPRHNKSGKRVLLTSVYIGTIDNEAFVGPETVDETAKVIAVSHGPSGSNYEYLAKLEQALAQMPIMKERGRITDHYLTALLETVNKYR", "length": 232 }, "evidence": [ { "id": "Q9CQG1", "url": "https://omabrowser.org/oma/group/Q9CQG1/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q641Z5-1", "protein_name": "Putative glutathione-specific gamma-glutamylcyclotransferase 2", "gene_name": "Chac2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPGGSVWGVAYKLPVGKEEEVKTYLDFREKGGYRTTTVIFYPKDSTTKPFSVLLYIGTCDNPNYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELADSIRKLVPEDADEHLFSLEKLVKERLEGK", "length": 178 }, "evidence": [ { "id": "45233846", "url": "http://www.informatics.jax.org/homology/45233846", "database": "MGI" }, { "id": "Q9CQG1", "url": "https://omabrowser.org/oma/group/Q9CQG1/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8WUX2-1", "protein_name": "Glutathione-specific gamma-glutamylcyclotransferase 2", "gene_name": "CHAC2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI", "length": 184 }, "evidence": [ { "id": "45233846", "url": "http://www.informatics.jax.org/homology/45233846", "database": "MGI" }, { "id": "Q9CQG1", "url": "https://omabrowser.org/oma/group/Q9CQG1/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "gamma-glutamylcyclotransferase activity", "id": "GO:0003839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003839", "evidence": [ { "database": "UniProtKB", "id": "Q9CQG1", "url": "https://www.uniprot.org/uniprot/Q9CQG1" } ], "pmid": "" }, { "name": "glutathione specific gamma-glutamylcyclotransferase activity", "id": "GO:0061928", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061928", "evidence": [ { "database": "UniProtKB", "id": "Q9CQG1", "url": "https://www.uniprot.org/uniprot/Q9CQG1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "glutathione catabolic process", "id": "GO:0006751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006751", "evidence": [ { "database": "UniProtKB", "id": "Q9CQG1", "url": "https://www.uniprot.org/uniprot/Q9CQG1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9CQG1", "url": "https://www.uniprot.org/uniprot/Q9CQG1" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9CQG1", "url": "https://www.uniprot.org/uniprot/Q9CQG1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 27, "end_pos": 29, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "47724", "name": "", "equation": "glutathione = 5-oxo-L-proline + L-cysteinylglycine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "B3STU3-1", "Q641Z5-1", "Q8WUX2-1", "Q9BUX1-1", "Q8R3J5-1", "Q9CQG1-1", "P32656-1", "Q54LB6-1", "Q9VYK7-1", "Q9VCI9-1" ], "evidence": [ { "id": "47724", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/47724" } ] }, { "id": "R-MMU-6785928", "name": "CHAC1,2 cleaves GSH to OPRO and CysGly", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-1247904" ], "enzyme_list": [ "Q9CQG1-1", "Q8R3J5-1" ], "evidence": [ { "id": "R-MMU-6785928", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-6785928" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1247904", "participant_name": "CysGly [cytosol]", "crossref": [ { "id": "000004095652", "database": "ZINC", "url": "" }, { "id": "61694", "database": "ChEBI", "url": "" }, { "id": "61694", "database": "ChEBI", "url": "" }, { "id": "000004095652", "database": "ZINC", "url": "" }, { "id": "61694", "database": "ChEBI", "url": "" }, { "id": "000004095652", "database": "ZINC", "url": "" }, { "id": "61694", "database": "ChEBI", "url": "" }, { "id": "000004095652", "database": "ZINC", "url": "" }, { "id": "61694", "database": "ChEBI", "url": "" }, { "id": "000004095652", "database": "ZINC", "url": "" }, { "id": "61694", "database": "ChEBI", "url": "" }, { "id": "000004095652", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "B3STU3", "gene_name": "Chac1", "activity": [ { "ec_number": "4.3.2.7", "activity": "glutathione = 5-oxo-L-proline + L-cysteinylglycine.", "evidence": [ { "id": "B3STU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B3STU3" } ] }, { "ec_number": "4.3.2.7", "activity": "", "evidence": [ { "id": "B3STU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B3STU3" } ] } ] }, { "uniprot_ac": "P32656", "gene_name": "GCG1", "activity": [ { "ec_number": "4.3.2.7", "activity": "glutathione = 5-oxo-L-proline + L-cysteinylglycine.", "evidence": [ { "id": "P32656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32656" } ] }, { "ec_number": "4.3.2.7", "activity": "", "evidence": [ { "id": "P32656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32656" } ] } ] }, { "uniprot_ac": "Q54LB6", "gene_name": "", "activity": [ { "ec_number": "4.3.2.7", "activity": "glutathione = 5-oxo-L-proline + L-cysteinylglycine.", "evidence": [ { "id": "Q54LB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54LB6" } ] }, { "ec_number": "4.3.2.7", "activity": "", "evidence": [ { "id": "Q54LB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54LB6" } ] } ] }, { "uniprot_ac": "Q641Z5", "gene_name": "Chac2", "activity": [ { "ec_number": "4.3.2.7", "activity": "glutathione = 5-oxo-L-proline + L-cysteinylglycine.", "evidence": [ { "id": "Q641Z5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641Z5" } ] }, { "ec_number": "4.3.2.7", "activity": "", "evidence": [ { "id": "Q641Z5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q641Z5" } ] } ] }, { "uniprot_ac": "Q8R3J5", "gene_name": "Chac1", "activity": [ { "ec_number": "4.3.2.7", "activity": "glutathione = 5-oxo-L-proline + L-cysteinylglycine.", "evidence": [ { "id": "Q8R3J5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3J5" } ] }, { "ec_number": "4.3.2.7", "activity": "", "evidence": [ { "id": "Q8R3J5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R3J5" } ] } ] }, { "uniprot_ac": "Q8WUX2", "gene_name": "CHAC2", "activity": [ { "ec_number": "4.3.2.7", "activity": "glutathione = 5-oxo-L-proline + L-cysteinylglycine.", "evidence": [ { "id": "Q8WUX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUX2" } ] }, { "ec_number": "4.3.2.7", "activity": "", "evidence": [ { "id": "Q8WUX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WUX2" } ] } ] }, { "uniprot_ac": "Q9BUX1", "gene_name": "CHAC1", "activity": [ { "ec_number": "4.3.2.7", "activity": "glutathione = 5-oxo-L-proline + L-cysteinylglycine.", "evidence": [ { "id": "Q9BUX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BUX1" } ] }, { "ec_number": "4.3.2.7", "activity": "", "evidence": [ { "id": "Q9BUX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BUX1" } ] } ] }, { "uniprot_ac": "Q9CQG1", "gene_name": "Chac2", "activity": [ { "ec_number": "4.3.2.7", "activity": "glutathione = 5-oxo-L-proline + L-cysteinylglycine.", "evidence": [ { "id": "Q9CQG1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQG1" } ] }, { "ec_number": "4.3.2.7", "activity": "", "evidence": [ { "id": "Q9CQG1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQG1" } ] } ] }, { "uniprot_ac": "Q9VCI9", "gene_name": "Dmel\\CG10365", "activity": [ { "ec_number": "4.3.2.7", "activity": "glutathione = 5-oxo-L-proline + L-cysteinylglycine.", "evidence": [ { "id": "Q9VCI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCI9" } ] }, { "ec_number": "4.3.2.7", "activity": "", "evidence": [ { "id": "Q9VCI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCI9" } ] } ] }, { "uniprot_ac": "Q9VYK7", "gene_name": "Dmel\\CG2540", "activity": [ { "ec_number": "4.3.2.7", "activity": "glutathione = 5-oxo-L-proline + L-cysteinylglycine.", "evidence": [ { "id": "Q9VYK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYK7" } ] }, { "ec_number": "4.3.2.7", "activity": "", "evidence": [ { "id": "Q9VYK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYK7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }