{ "uniprot_canonical_ac": "Q9CQB7-1", "uniprot_ac": "Q9CQB7", "uniprot_id": "LYRM1_MOUSE", "mass": { "chemical_mass": 14224.0, "monoisotopic_mass": 14224.0 }, "refseq": { "ac": "NP_001272888", "name": "LYR motif-containing protein 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888" }, "gene_names": [ { "name": "Lyrm1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CQB7", "id": "Q9CQB7" }, { "name": "1110065L10Rik; 2310004B22Rik; 4930404J24Rik", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888", "id": "NP_001272888" }, { "name": "Lyrm1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888", "id": "NP_001272888" } ], "protein_names": [ { "name": "LYR motif-containing protein 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CQB7" }, { "name": "LYR motif-containing protein 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888", "id": "NP_001272888" } ], "function": [ { "annotation": "Alpha-LA protects 3T3-L1 adipocytes from LYRM1-induced insulin resistance partially via its capacity to restore mitochondrial function and/or increase phosphorylation of IRS-1 and Akt.", "evidence": [ { "database": "RefSeq", "id": "NP_001272888", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888" }, { "database": "PubMed", "id": "22820890", "url": "https://glygen.org/publication/PubMed/22820890" } ] }, { "annotation": "FCCP-induced mitochondrial dysfunction and insulin resistance are ameliorated by knockdown of LYRM1", "evidence": [ { "database": "RefSeq", "id": "NP_001272888", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888" }, { "database": "PubMed", "id": "24771405", "url": "https://glygen.org/publication/PubMed/24771405" } ] }, { "annotation": "Knockdown of LYRM1 induced mitochondrial impairment in P19 cells during differentiation, which was reflected by decreased ATP synthesis, lower MMP and increased ROS levels.", "evidence": [ { "database": "RefSeq", "id": "NP_001272888", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888" }, { "database": "PubMed", "id": "26759027", "url": "https://glygen.org/publication/PubMed/26759027" } ] }, { "annotation": "Knockdown of the Lyrm1 gene in adipocytes resulted in dramatically increased cellular ATP production, mitochondrial membrane potentials and levels Ucp2 mRNA, while ROS levels were significantly decreased.", "evidence": [ { "database": "RefSeq", "id": "NP_001272888", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888" }, { "database": "PubMed", "id": "22249831", "url": "https://glygen.org/publication/PubMed/22249831" } ] }, { "annotation": "May promote cell proliferation and inhibition of apoptosis of preadipocytes.", "evidence": [ { "database": "UniProtKB", "id": "Q9CQB7", "url": "https://www.uniprot.org/uniprot/Q9CQB7#function" } ] }, { "annotation": "Results suggest that the expression of LYRM1 mRNA is affected by a variety of factors that are related to insulin sensitivity; LYRM1 may be an important mediator in the development of obesity-related insulin resistance", "evidence": [ { "database": "RefSeq", "id": "NP_001272888", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888" }, { "database": "PubMed", "id": "22110480", "url": "https://glygen.org/publication/PubMed/22110480" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CQB7", "url": "https://www.uniprot.org/uniprot/Q9CQB7" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Lyrm1", "url": "https://www.uniprot.org/uniprot/Q9CQB7", "locus": { "chromosome": "7", "start_pos": 119556186, "end_pos": 119495084, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000030922", "url": "https://www.ensembl.org/id/ENSMUSG00000030922" } ] } } ], "crossref": [ { "id": "ENSMUSG00000030922", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000030922", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd20261", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20261", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "73919", "url": "https://www.ncbi.nlm.nih.gov/gene/73919", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR008011", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008011", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040330", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040330", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045294", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045294", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:73919", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:73919", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1921169", "url": "http://www.informatics.jax.org/marker/MGI:1921169", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "QCIEECK", "url": "https://omabrowser.org/oma/group/QCIEECK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "168013at2759", "url": "http://www.orthodb.org/?query=168013at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14273", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14273", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14273:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14273:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05347", "url": "http://pfam.xfam.org/family/PF05347", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CQB7", "url": "http://purl.obolibrary.org/obo/PR_Q9CQB7", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001272888", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9CQB7", "url": "https://www.uniprot.org/uniprot/Q9CQB7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CQB7-1", "url": "https://www.uniprot.org/uniprot/Q9CQB7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTAATRQEVLCLYRSIFRLARKWQAASGQMEDTIEEKQYILKEARTLFQKNKNLTDPELIKQCIVECTARIEIGLHYQIPYPRPIHLPPMGLTARRGRGLQTQEKLRKLSKPVYLKSHDEVS", "length": 122, "header": "sp|Q9CQB7-1|LYRM1_MOUSE Isoform 1 of LYR motif-containing protein 1 OS=Mus musculus OX=10090 GN=Lyrm1 PE=1 SV=1 CANONICAL=Q9CQB7-1" }, "isoforms": [ { "isoform_ac": "Q9CQB7-1", "url": "", "sequence": { "sequence": "MTAATRQEVLCLYRSIFRLARKWQAASGQMEDTIEEKQYILKEARTLFQKNKNLTDPELIKQCIVECTARIEIGLHYQIPYPRPIHLPPMGLTARRGRGLQTQEKLRKLSKPVYLKSHDEVS", "length": 122, "header": "sp|Q9CQB7-1|LYRM1_MOUSE Isoform 1 of LYR motif-containing protein 1 OS=Mus musculus OX=10090 GN=Lyrm1 PE=1 SV=1 CANONICAL=Q9CQB7-1" }, "locus": { "chromosome": "7", "start_pos": 119515477, "end_pos": 119509027, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000054440", "url": "https://www.ensembl.org/id/ENSMUST00000054440" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000051616", "url": "https://www.ensembl.org/id/ENSMUSP00000051616" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Regulation of LYRM1 gene expression by free fatty acids, adipokines, and rosiglitazone in 3T3-L1 adipocytes.", "journal": "Experimental diabetes research", "date": "2012", "authors": "Zhang M, Zhao HM, Qin ZY, Qin R, Chen XH, Zhao YP, Zhang CM, Gao CL, Zhu C, Ji CB, Cao XG, Guo XR", "evidence": [ { "database": "RefSeq", "id": "NP_001272888", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888" } ], "reference": [ { "type": "PubMed", "id": "22110480", "url": "https://glygen.org/publication/PubMed/22110480" } ] }, { "title": "Effects of Lyrm1 knockdown on mitochondrial function in 3 T3-L1 murine adipocytes.", "journal": "Journal of bioenergetics and biomembranes", "date": "2012", "authors": "Zhu GZ, Zhang M, Kou CZ, Ni YH, Ji CB, Cao XG, Guo XR", "evidence": [ { "database": "RefSeq", "id": "NP_001272888", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888" } ], "reference": [ { "type": "PubMed", "id": "22249831", "url": "https://glygen.org/publication/PubMed/22249831" } ] }, { "title": "alpha-Lipoic acid ameliorates impaired glucose uptake in LYRM1 overexpressing 3T3-L1 adipocytes through the IRS-1/Akt signaling pathway.", "journal": "Journal of bioenergetics and biomembranes", "date": "2012", "authors": "Qin ZY, Zhang M, Guo XR, Wang YM, Zhu GZ, Ni YH, Zhao YP, Qiu J, Kou CZ, Qin R, Cao XG", "evidence": [ { "database": "RefSeq", "id": "NP_001272888", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888" } ], "reference": [ { "type": "PubMed", "id": "22820890", "url": "https://glygen.org/publication/PubMed/22820890" } ] }, { "title": "Knockdown of LYRM1 rescues insulin resistance and mitochondrial dysfunction induced by FCCP in 3T3-L1 adipocytes.", "journal": "Cell biochemistry and biophysics", "date": "2014", "authors": "Zhang M, Qin ZY, Dai YM, Wang YM, Zhu GZ, Zhao YP, Ji CB, Zhu JG, Shi CM, Qiu J, Cao XG, Guo XR", "evidence": [ { "database": "RefSeq", "id": "NP_001272888", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888" } ], "reference": [ { "type": "PubMed", "id": "24771405", "url": "https://glygen.org/publication/PubMed/24771405" } ] }, { "title": "Effect of LYRM1 knockdown on proliferation, apoptosis, differentiation and mitochondrial function in the P19 cell model of cardiac differentiation in vitro.", "journal": "Journal of bioenergetics and biomembranes", "date": "2016", "authors": "Chen YM, Li X, Song GX, Liu M, Fan Y, Wu LJ, Li H, Zhang QJ, Liu YQ, Qian LM", "evidence": [ { "database": "RefSeq", "id": "NP_001272888", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001272888" } ], "reference": [ { "type": "PubMed", "id": "26759027", "url": "https://glygen.org/publication/PubMed/26759027" } ] } ], "pathway": [ { "id": "mmu:73919", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:73919", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "O43325-1", "protein_name": "LYR motif-containing protein 1", "gene_name": "LYRM1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTTATRQEVLGLYRSIFRLARKWQATSGQMEDTIKEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRPIHLPPMGLTPLRGRGLRSQEKLRKLSKPVYLRSHDEVS", "length": 122 }, "evidence": [ { "id": "45232836", "url": "http://www.informatics.jax.org/homology/45232836", "database": "MGI" }, { "id": "Q9CQB7", "url": "https://omabrowser.org/oma/group/Q9CQB7/", "database": "OMA" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9CQB7", "url": "https://www.uniprot.org/uniprot/Q9CQB7" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "Q9CQB7", "url": "https://www.uniprot.org/uniprot/Q9CQB7" } ], "pmid": "" }, { "name": "midbody", "id": "GO:0030496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030496", "evidence": [ { "database": "UniProtKB", "id": "Q9CQB7", "url": "https://www.uniprot.org/uniprot/Q9CQB7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 53, "end_pos": 55, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }