{
    "uniprot_canonical_ac": "Q9CQ68-1",
    "uniprot_ac": "Q9CQ68",
    "uniprot_id": "Q9CQ68_MOUSE",
    "mass": {
        "chemical_mass": 17093.0,
        "monoisotopic_mass": 17093.0
    },
    "refseq": {
        "ac": "NP_079779",
        "name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial-like",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079779"
    },
    "gene_names": [
        {
            "name": "Ndufb11b",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/Q9CQ68",
            "id": "Q9CQ68"
        },
        {
            "name": "1700029P11Rik",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079779",
            "id": "NP_079779"
        },
        {
            "name": "1700029P11Rik",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/Q9CQ68",
            "id": "Q9CQ68"
        },
        {
            "name": "Ndufb11b",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079779",
            "id": "NP_079779"
        }
    ],
    "protein_names": [
        {
            "name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "Q9CQ68"
        },
        {
            "name": "Complex I-ESSS",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9CQ68"
        },
        {
            "name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial-like",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079779",
            "id": "NP_079779"
        },
        {
            "name": "NADH-ubiquinone oxidoreductase ESSS subunit",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "Q9CQ68"
        }
    ],
    "function": [
        {
            "annotation": "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9CQ68",
                    "url": "https://www.uniprot.org/uniprot/Q9CQ68#function"
                },
                {
                    "database": "UniProtKB",
                    "id": "ARBA00003195",
                    "url": "https://www.uniprot.org/uniprot/ARBA00003195#function"
                }
            ]
        }
    ],
    "disease": [
        {
            "disease_id": "DOID:0111876",
            "recommended_name": {
                "id": "DOID:0111876",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0111876",
                "name": "linear skin defects with multiple congenital anomalies 3",
                "description": "A linear skin defects with multiple congenital anomalies characterized by linear skin defects, cardiomyopathy, and various other congenital anomalies that has_material_basis_in heterozygous mutation in the NDUFB11 gene on chromosome Xp11.3."
            },
            "synonyms": [
                {
                    "id": "DOID:0111876",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0111876",
                    "name": "LSDMCA3",
                    "description": ""
                },
                {
                    "id": "DOID:0111876",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0111876",
                    "name": "linear skin defects with cardiomyopathy and other congenital anomalies",
                    "description": ""
                },
                {
                    "id": "MONDO:0010494",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010494",
                    "name": "linear skin defects with multiple congenital anomalies 3",
                    "description": "Any microphthalmia with linear skin defects syndrome in which the cause of the disease is a mutation in the NDUFB11 gene."
                },
                {
                    "id": "MONDO:0010494",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010494",
                    "name": "NDUFB11 microphthalmia with linear skin defects syndrome",
                    "description": ""
                },
                {
                    "id": "MONDO:0010494",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010494",
                    "name": "linear skin defects with multiple congenital anomalies 3",
                    "description": ""
                },
                {
                    "id": "MONDO:0010494",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010494",
                    "name": "linear skin defects with multiple congenital anomalies 3, X-linked dominant",
                    "description": ""
                },
                {
                    "id": "MONDO:0010494",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010494",
                    "name": "linear skin defects with multiple congenital anomalies type 3",
                    "description": ""
                },
                {
                    "id": "MONDO:0010494",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010494",
                    "name": "microphthalmia with linear skin defects syndrome caused by mutation in NDUFB11",
                    "description": ""
                },
                {
                    "id": "MONDO:0010494",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010494",
                    "name": "LSDMCA3",
                    "description": ""
                },
                {
                    "id": "MONDO:0010494",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0010494",
                    "name": "linear skin defects with cardiomyopathy and Other congenital anomalies",
                    "description": ""
                },
                {
                    "id": "MIM:300952",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/300952",
                    "name": "Linear skin defects with multiple congenital anomalies 3",
                    "description": "Linear skin defects with multiple congenital anomalies 3"
                }
            ],
            "evidence": [
                {
                    "id": "0111876",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0111876"
                }
            ]
        },
        {
            "disease_id": "DOID:0112098",
            "recommended_name": {
                "id": "DOID:0112098",
                "resource": "Disease Ontology",
                "url": "http://disease-ontology.org/term/DOID:0112098",
                "name": "nuclear type mitochondrial complex I deficiency 30",
                "description": "A nuclear type mitochondrial complex I deficiency that has_material_basis_in hemizygous mutation in the NDUFB11 gene on chromosome Xp11.3."
            },
            "synonyms": [
                {
                    "id": "DOID:0112098",
                    "resource": "Disease Ontology",
                    "url": "http://disease-ontology.org/term/DOID:0112098",
                    "name": "MC1DN30",
                    "description": ""
                },
                {
                    "id": "MONDO:0026721",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0026721",
                    "name": "mitochondrial complex 1 deficiency, nuclear type 30",
                    "description": ""
                },
                {
                    "id": "MONDO:0026721",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0026721",
                    "name": "MC1DN30",
                    "description": ""
                },
                {
                    "id": "MONDO:0026721",
                    "resource": "MONDO",
                    "url": "https://monarchinitiative.org/disease/MONDO:0026721",
                    "name": "MITOCHONDRIAL COMPLEX I DEFICIENCY, NUCLEAR TYPE 30",
                    "description": ""
                },
                {
                    "id": "MIM:301021",
                    "resource": "MIM",
                    "url": "https://www.omim.org/entry/301021",
                    "name": "Mitochondrial complex I deficiency, nuclear type 30",
                    "description": "Mitochondrial complex I deficiency, nuclear type 30"
                }
            ],
            "evidence": [
                {
                    "id": "0112098",
                    "database": "Alliance of Genome Resources",
                    "url": "https://www.alliancegenome.org/disease/DOID:0112098"
                }
            ]
        }
    ],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Mus musculus",
            "taxid": 10090,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "Q9CQ68",
                    "url": "https://www.uniprot.org/uniprot/Q9CQ68"
                }
            ],
            "common_name": "Mouse"
        }
    ],
    "gene": [
        {
            "name": "Ndufb11b",
            "url": "https://www.uniprot.org/uniprot/Q9CQ68",
            "locus": {
                "chromosome": "15",
                "start_pos": 81865764,
                "end_pos": 81864741,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Gene",
                        "id": "ENSMUSG00000061633",
                        "url": "https://www.ensembl.org/id/ENSMUSG00000061633"
                    }
                ]
            }
        }
    ],
    "crossref": [
        {
            "id": "ENSMUSG00000061633",
            "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000061633",
            "database": "Bgee",
            "categories": [
                "Gene Expression"
            ]
        },
        {
            "id": "66346",
            "url": "https://www.ncbi.nlm.nih.gov/gene/66346",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR019329",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR019329",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "mmu:66346",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66346",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "1913596",
            "url": "http://www.informatics.jax.org/marker/MGI:1913596",
            "database": "MGI",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "DCRMQER",
            "url": "https://omabrowser.org/oma/group/DCRMQER/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "2872137at2759",
            "url": "http://www.orthodb.org/?query=2872137at2759",
            "database": "OrthoDB",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR13327",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13327",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR13327:SF2",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13327:SF2",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF10183",
            "url": "http://pfam.xfam.org/family/PF10183",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "NP_079779",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_079779",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9CQ68",
            "url": "https://www.uniprot.org/uniprot/Q9CQ68",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "Q9CQ68-1",
            "url": "https://www.uniprot.org/uniprot/Q9CQ68-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MAAWRLSLCARSLSAIRRLQAAPLCWKSSSSRAVVARSAAARKEQEEPTVQWMEDPDPEDENVYLKNPHFHGYDDDPKVDALNMHAVFFFGFSIALVLGTTFVAYVPNYKMIEWARREAAMLVKHREASGLPIMESNYFDPTKINLLEDD",
        "length": 150,
        "header": "tr|Q9CQ68-1|Q9CQ68_MOUSE Isoform 1 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial  OS=Mus musculus OX=10090 GN=Ndufb11b PE=1 SV=1 CANONICAL=Q9CQ68-1"
    },
    "isoforms": [
        {
            "isoform_ac": "Q9CQ68-1",
            "url": "",
            "sequence": {
                "sequence": "MAAWRLSLCARSLSAIRRLQAAPLCWKSSSSRAVVARSAAARKEQEEPTVQWMEDPDPEDENVYLKNPHFHGYDDDPKVDALNMHAVFFFGFSIALVLGTTFVAYVPNYKMIEWARREAAMLVKHREASGLPIMESNYFDPTKINLLEDD",
                "length": 150,
                "header": "tr|Q9CQ68-1|Q9CQ68_MOUSE Isoform 1 of NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial  OS=Mus musculus OX=10090 GN=Ndufb11b PE=1 SV=1 CANONICAL=Q9CQ68-1"
            },
            "locus": {
                "chromosome": "15",
                "start_pos": 81865210,
                "end_pos": 81864761,
                "strand": "-",
                "evidence": [
                    {
                        "database": "Ensembl Transcript",
                        "id": "ENSMUST00000074608.4",
                        "url": "https://www.ensembl.org/id/ENSMUST00000074608.4"
                    },
                    {
                        "database": "Ensembl Peptide",
                        "id": "ENSMUSP00000074190.4",
                        "url": "https://www.ensembl.org/id/ENSMUSP00000074190.4"
                    }
                ]
            }
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [],
    "pathway": [
        {
            "id": "mmu:66346",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66346",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [
        {
            "uniprot_canonical_ac": "D4AAT2-1",
            "protein_name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial",
            "gene_name": "Ndufb11b",
            "tax_id": 10116,
            "organism": "Rattus norvegicus",
            "sequence": {
                "sequence": "MAAWRLSLCARSLFAIRGLQAAPLRWKSSSSRAVIARSAAASKKRREEPTIQWMEDPEPEDENVYLKNPNFHGYDDDPNMDVWNMQAVFFFGFSIALVLGTTFVAYVPDYRMLEWAHREAMMLVKYREANGLPLMESNRFDPSKINLLDNK",
                "length": 151
            },
            "evidence": [
                {
                    "id": "45233456",
                    "url": "http://www.informatics.jax.org/homology/45233456",
                    "database": "MGI"
                }
            ],
            "common_name": "Rat"
        },
        {
            "uniprot_canonical_ac": "Q9NX14-1",
            "protein_name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial",
            "gene_name": "NDUFB11",
            "tax_id": 9606,
            "organism": "Homo sapiens",
            "sequence": {
                "sequence": "MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE",
                "length": 153
            },
            "evidence": [
                {
                    "id": "45233456",
                    "url": "http://www.informatics.jax.org/homology/45233456",
                    "database": "MGI"
                }
            ],
            "common_name": "Human"
        }
    ],
    "go_annotation": {
        "categories": [
            {
                "name": "Cellular Component",
                "total": 2,
                "go_terms": [
                    {
                        "name": "mitochondrion",
                        "id": "GO:0005739",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CQ68",
                                "url": "https://www.uniprot.org/uniprot/Q9CQ68"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "mitochondrial respiratory chain complex I",
                        "id": "GO:0005747",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005747",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CQ68",
                                "url": "https://www.uniprot.org/uniprot/Q9CQ68"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 1,
                "go_terms": [
                    {
                        "name": "mitochondrial respiratory chain complex I assembly",
                        "id": "GO:0032981",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032981",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "Q9CQ68",
                                "url": "https://www.uniprot.org/uniprot/Q9CQ68"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [
        {
            "name": "homologset.mgi",
            "label": "MGI Homologs"
        }
    ],
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                }
            ],
            "sort_fields": []
        }
    ]
}