{ "uniprot_canonical_ac": "Q9CQ65-1", "uniprot_ac": "Q9CQ65", "uniprot_id": "MTAP_MOUSE", "mass": { "chemical_mass": 31062.0, "monoisotopic_mass": 31062.0 }, "refseq": { "ac": "NP_077753", "name": "S-methyl-5'-thioadenosine phosphorylase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753" }, "gene_names": [ { "name": "Mtap", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CQ65", "id": "Q9CQ65" }, { "name": "1300019I21Rik; MSAP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753", "id": "NP_077753" }, { "name": "Mtap", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753", "id": "NP_077753" } ], "protein_names": [ { "name": "S-methyl-5'-thioadenosine phosphorylase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CQ65" }, { "name": "2.4.2.28", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CQ65" }, { "name": "5'-methylthioadenosine phosphorylase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CQ65" }, { "name": "MTA phosphorylase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CQ65" }, { "name": "MTAPase; MTA phosphorylase; 5'-methylthioadenosine phosphorylase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753", "id": "NP_077753" }, { "name": "MTAPase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CQ65" }, { "name": "MTAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CQ65" }, { "name": "S-methyl-5'-thioadenosine phosphorylase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753", "id": "NP_077753" } ], "function": [ { "annotation": "Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ65", "url": "https://www.uniprot.org/uniprot/Q9CQ65#function" }, { "database": "UniProtKB", "id": "MF_03155", "url": "https://www.uniprot.org/uniprot/MF_03155#function" } ] }, { "annotation": "Data demonstrate that MTAP deficiency leads to accumulation of MTA inducing deregulation of central cellular pathways that control cell fate and contributes to the onset of a proliferative and antiapoptotic phenotype in the liver.", "evidence": [ { "database": "RefSeq", "id": "NP_077753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753" }, { "database": "PubMed", "id": "26819315", "url": "https://glygen.org/publication/PubMed/26819315" } ] }, { "annotation": "Germline Mutations in Mtap is associated with lymphomagenesis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_077753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753" }, { "database": "PubMed", "id": "23840755", "url": "https://glygen.org/publication/PubMed/23840755" } ] }, { "annotation": "MTAP-mediated regulation of methylthioadenosine links polyamine metabolism with NF-kappaB activation and apoptosis in hepatic stellate cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_077753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753" }, { "database": "PubMed", "id": "24324622", "url": "https://glygen.org/publication/PubMed/24324622" } ] }, { "annotation": "Regulation of MTAP by reactive oxygen species might participate in the redox regulation of the methionine catabolic pathway in the liver", "evidence": [ { "database": "RefSeq", "id": "NP_077753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753" }, { "database": "PubMed", "id": "18237276", "url": "https://glygen.org/publication/PubMed/18237276" } ] } ], "disease": [ { "disease_id": "DOID:0050625", "recommended_name": { "id": "DOID:0050625", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050625", "name": "biliary tract benign neoplasm", "description": "A hepatobiliary benign neoplasm located_in the biliary tract." }, "synonyms": [ { "id": "DOID:0050625", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050625", "name": "extrahepatic bile duct neoplasm", "description": "" }, { "id": "DOID:0050625", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050625", "name": "neoplasm of extrahepatic bile ducts", "description": "" }, { "id": "DOID:0050625", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050625", "name": "tumor of the extrahepatic bile duct", "description": "" } ], "evidence": [ { "id": "0050625", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0050625" } ] }, { "disease_id": "DOID:0080664", "recommended_name": { "id": "DOID:0080664", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080664", "name": "diaphyseal medullary stenosis with malignant fibrous histiocytoma", "description": "An osteochondrodysplasia that is characterized by pathologic fractures due to abnormal cortical growth and diaphyseal medullary stenosis and that has_material_basis_in heterozygous mutation in the MTAP gene on chromosome 9p21." }, "synonyms": [ { "id": "DOID:0080664", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080664", "name": "Hardcastle syndrome", "description": "" }, { "id": "DOID:0080664", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080664", "name": "diaphyseal medullary stenosis-malignant fibrous histiocytoma syndrome", "description": "" }, { "id": "DOID:0080664", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080664", "name": "bone dysplasia-medullary fibrosarcoma syndrome", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "diaphyseal medullary stenosis-bone malignancy syndrome", "description": "Diaphyseal medullary stenosis with malignant fibrous histiocytoma is a very rare autosomal dominant bone dysplasia/cancer syndrome characterized clinically by bone infarctions, cortical growth abnormalities, pathological fractures, and development of bone sarcoma (malignant fibrous histiocytoma)." }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "DMS-MFH", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "Hardcastle syndrome", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "Hardcastle's syndrome", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "bone dysplasia-medullary fibrosarcoma syndrome", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "diaphyseal medullary stenosis-bone malignancy syndrome", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "diaphyseal medullary stenosis-malignant fibrous histiocytoma syndrome", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "BDMF", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "DMSMFH", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "bone dysplasia with malignant fibrous histiocytoma", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "bone dysplasia with medullary fibrosarcoma", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "diaphyseal medullary stenosis with malignant fibrous histiocytoma", "description": "" }, { "id": "MONDO:0007205", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007205", "name": "myopathy, limb-girdle, with bone fragility", "description": "" }, { "id": "MIM:112250", "resource": "MIM", "url": "https://www.omim.org/entry/112250", "name": "Diaphyseal medullary stenosis with malignant fibrous histiocytoma", "description": "Diaphyseal medullary stenosis with malignant fibrous histiocytoma" } ], "evidence": [ { "id": "0080664", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080664" } ] }, { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ], "evidence": [ { "id": "1793", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:1793" } ] }, { "disease_id": "DOID:4608", "recommended_name": { "id": "DOID:4608", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4608", "name": "common bile duct neoplasm", "description": "" }, "synonyms": [ { "id": "DOID:4608", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4608", "name": "neoplasm of common bile duct", "description": "" } ], "evidence": [ { "id": "4608", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:4608" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CQ65", "url": "https://www.uniprot.org/uniprot/Q9CQ65" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mtap", "url": "https://www.uniprot.org/uniprot/Q9CQ65", "locus": { "chromosome": "4", "start_pos": 89099318, "end_pos": 89055359, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000062937", "url": "https://www.ensembl.org/id/ENSMUSG00000062937" } ] } } ], "crossref": [ { "id": "ENSMUSG00000062937", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000062937", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.4.2.28", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.2.28&UniProtAcc=Q9CQ65", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd09010", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09010", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2663", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2663", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "66902", "url": "https://www.ncbi.nlm.nih.gov/gene/66902", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9CQ65", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9CQ65*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000845", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000845", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010044", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010044", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018099", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018099", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035994", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035994", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:66902", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66902", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1914152", "url": "http://www.informatics.jax.org/marker/MGI:1914152", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9CQ65", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9CQ65", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "ADPFCPE", "url": "https://omabrowser.org/oma/group/ADPFCPE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "168017at2759", "url": "http://www.orthodb.org/?query=168017at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR42679", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR42679", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR42679:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR42679:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01048", "url": "http://pfam.xfam.org/family/PF01048", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CQ65", "url": "http://purl.obolibrary.org/obo/PR_Q9CQ65", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-1237112", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1237112", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_077753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "11852", "url": "https://www.rhea-db.org/rhea/11852", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q9CQ65", "url": "https://www.uniprot.org/uniprot/Q9CQ65", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CQ65-1", "url": "https://www.uniprot.org/uniprot/Q9CQ65-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASGSACTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDMVIIDQFIDRTSLRPQTFYDGSHCSARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTIVTIEGPRFSSRAESLIFRTWGADVVNMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDGVLKTMKENANKAKSLLLTTIPQIGSMEWSETLRNLKNMAQFSVLPPRH", "length": 283, "header": "sp|Q9CQ65-1|MTAP_MOUSE Isoform 1 of S-methyl-5'-thioadenosine phosphorylase OS=Mus musculus OX=10090 GN=Mtap PE=1 SV=1 CANONICAL=Q9CQ65-1" }, "isoforms": [ { "isoform_ac": "Q9CQ65-1", "url": "", "sequence": { "sequence": "MASGSACTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDMVIIDQFIDRTSLRPQTFYDGSHCSARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTIVTIEGPRFSSRAESLIFRTWGADVVNMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDGVLKTMKENANKAKSLLLTTIPQIGSMEWSETLRNLKNMAQFSVLPPRH", "length": 283, "header": "sp|Q9CQ65-1|MTAP_MOUSE Isoform 1 of S-methyl-5'-thioadenosine phosphorylase OS=Mus musculus OX=10090 GN=Mtap PE=1 SV=1 CANONICAL=Q9CQ65-1" }, "locus": { "chromosome": "4", "start_pos": 89097740, "end_pos": 89055729, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000058030", "url": "https://www.ensembl.org/id/ENSMUST00000058030" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000061092", "url": "https://www.ensembl.org/id/ENSMUSP00000061092" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "Q9CQ65", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9CQ65" }, { "id": "25153642", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25153642" }, { "id": "28528544", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28528544" }, { "id": "24788674", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24788674" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Molecular characterization of 5'-deoxy-5'-methylthioadenosine phosphorylase-deficient mutant clones of murine lymphoma cell line R1.1.", "journal": "Cancer Sci.", "date": "2003", "authors": "Kadariya Y, Nishioka J, Nakamura A, Kato-Nakazawa K, Nobori T", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ65", "url": "https://www.uniprot.org/uniprot/Q9CQ65" } ], "reference": [ { "type": "PubMed", "id": "12824877", "url": "https://glygen.org/publication/PubMed/12824877" } ] }, { "title": "Redox regulation of methylthioadenosine phosphorylase in liver cells: molecular mechanism and functional implications.", "journal": "The Biochemical journal", "date": "2008", "authors": "Fernandez-Irigoyen J, Santamaria M, Sanchez-Quiles V, Latasa MU, Santamaria E, Munoz J, Sanchez Del Pino MM, Valero ML, Prieto J, Avila MA, Corrales FJ", "evidence": [ { "database": "RefSeq", "id": "NP_077753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753" } ], "reference": [ { "type": "PubMed", "id": "18237276", "url": "https://glygen.org/publication/PubMed/18237276" } ] }, { "title": "SIRT5-mediated lysine desuccinylation impacts diverse metabolic pathways.", "journal": "Mol. Cell", "date": "2013", "authors": "Park J, Chen Y, Tishkoff DX, Peng C, Tan M, Dai L, Xie Z, Zhang Y, Zwaans BM, Skinner ME, Lombard DB, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ65", "url": "https://www.uniprot.org/uniprot/Q9CQ65" } ], "reference": [ { "type": "PubMed", "id": "23806337", "url": "https://glygen.org/publication/PubMed/23806337" } ] }, { "title": "Germline Mutations in Mtap Cooperate with Myc to Accelerate Tumorigenesis in Mice.", "journal": "PloS one", "date": "2013", "authors": "Kadariya Y, Tang B, Wang L, Al-Saleem T, Hayakawa K, Slifker MJ, Kruger WD", "evidence": [ { "database": "RefSeq", "id": "NP_077753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753" } ], "reference": [ { "type": "PubMed", "id": "23840755", "url": "https://glygen.org/publication/PubMed/23840755" } ] }, { "title": "Expression and function of methylthioadenosine phosphorylase in chronic liver disease.", "journal": "PloS one", "date": "2013", "authors": "Czech B, Dettmer K, Valletta D, Saugspier M, Koch A, Stevens AP, Thasler WE, Muller M, Oefner PJ, Bosserhoff AK, Hellerbrand C", "evidence": [ { "database": "RefSeq", "id": "NP_077753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753" } ], "reference": [ { "type": "PubMed", "id": "24324622", "url": "https://glygen.org/publication/PubMed/24324622" } ] }, { "title": "Identification of O-GlcNAc modification targets in mouse retinal pericytes: implication of p53 in pathogenesis of diabetic retinopathy.", "journal": "PloS one", "date": "2014", "authors": "Gurel Z, Zaro BW, Pratt MR, Sheibani N", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9CQ65", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9CQ65" } ], "reference": [ { "type": "PubMed", "id": "24788674", "url": "https://glygen.org/publication/PubMed/24788674" } ] }, { "title": "Changes in metabolic chemical reporter structure yield a selective probe of O-GlcNAc modification.", "journal": "Journal of the American Chemical Society", "date": "2014", "authors": "Chuh KN, Zaro BW, Piller F, Piller V, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9CQ65", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9CQ65" } ], "reference": [ { "type": "PubMed", "id": "25153642", "url": "https://glygen.org/publication/PubMed/25153642" } ] }, { "title": "Methylthioadenosine (MTA) Regulates Liver Cells Proteome and Methylproteome: Implications in Liver Biology and Disease.", "journal": "Molecular & cellular proteomics : MCP", "date": "2016", "authors": "Bigaud E, Corrales FJ", "evidence": [ { "database": "RefSeq", "id": "NP_077753", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_077753" } ], "reference": [ { "type": "PubMed", "id": "26819315", "url": "https://glygen.org/publication/PubMed/26819315" } ] }, { "title": "The New Chemical Reporter 6-Alkynyl-6-deoxy-GlcNAc Reveals O-GlcNAc Modification of the Apoptotic Caspases That Can Block the Cleavage/Activation of Caspase-8.", "journal": "Journal of the American Chemical Society", "date": "2017", "authors": "Chuh KN, Batt AR, Zaro BW, Darabedian N, Marotta NP, Brennan CK, Amirhekmat A, Pratt MR", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9CQ65", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9CQ65" } ], "reference": [ { "type": "PubMed", "id": "28528544", "url": "https://glygen.org/publication/PubMed/28528544" } ] } ], "pathway": [ { "id": "mmu:66902", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:66902", "resource": "KEGG Pathway" }, { "id": "R-MMU-1237112", "name": "Methionine salvage pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1237112", "resource": "Reactome", "description": "Methionine salvage pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2K583-1", "protein_name": "S-methyl-5'-thioadenosine phosphorylase", "gene_name": "Mtap", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASGSACTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRHHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDMVIIDQFIDRTSLRPQTFYDGSHCSARGVCHIPMAEPFCPKTREVLIEMAKKLGLRCHSKGTIVTIEGPRFSSRAESFIFRTWGADVINMTTVPEVVLAKEAGLCYASIAMATDYDCWKEHEEAVSVDGVLKTMKENANKAKSLLLTTIPQIGSMEWSETLRNLKNMAQSSVLPPRH", "length": 283 }, "evidence": [ { "id": "45232208", "url": "http://www.informatics.jax.org/homology/45232208", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q07938-1", "protein_name": "S-methyl-5'-thioadenosine phosphorylase", "gene_name": "MEU1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MNRIKNTFSVAKRLKLSKVMTNSELPSIFEGTVDLGIIGGTGLYNLDCLEPIALLPPMVTPWGTTSSPVTISQFVGTNSHFHVAFIARHGINHEYPPTKVPFRANMAALKNLNCKAVLSFSAVGSLQPHIKPRDFVLPQQIIDRTKGIRHSSYFNDEGLVGHVGFGQPFSQKFAEYIYQFKNEITNPESEEPCHLHYDKDMTVVCMEGPQFSTRAESKMYRMFGGHVINMSVIPEAKLARECELPYQMICMSTDYDAWRDEAEPVTVETVIGNLTNNGRNANILASKIIVSMAKEIPEFMHTGDGLRGSIKKSISTKPEAMSKETLERLRYLFPNYW", "length": 337 }, "evidence": [ { "id": "Q9CQ65", "url": "https://omabrowser.org/oma/group/Q9CQ65/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q13126-1", "protein_name": "S-methyl-5'-thioadenosine phosphorylase", "gene_name": "MTAP", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH", "length": 283 }, "evidence": [ { "id": "45232208", "url": "http://www.informatics.jax.org/homology/45232208", "database": "MGI" }, { "id": "Q9CQ65", "url": "https://omabrowser.org/oma/group/Q9CQ65/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9V813-1", "protein_name": "S-methyl-5'-thioadenosine phosphorylase", "gene_name": "Mtap", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MITIKCKDTNLDPLPVKIGIIGGSGLDDPDILEQRQERVVETPYGEPSDALIEGEINGVQCVLLARHGRKHDIMPSNVNYRANIWALRDVGCTHLIVSTACGSLREEIKPGNLVVPHDFIDRTTKRLQTFYDGKAQSPRGVCHLPMFPAFSERTRNILLQAAKELEIPAHDKATIVTIEGPRFSSRSESHMFRQWGGDLINMTTCPEVVLAKEAGLLYGSVAIATDYDCWRMGCEGVNVQDVLRTFAENVIKVKKILVNAVGRIAKEDWSEDILNAKQCVCNNTMSGAM", "length": 289 }, "evidence": [ { "id": "Q9CQ65", "url": "https://omabrowser.org/oma/group/Q9CQ65/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ65", "url": "https://www.uniprot.org/uniprot/Q9CQ65" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ65", "url": "https://www.uniprot.org/uniprot/Q9CQ65" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "purine ribonucleoside salvage", "id": "GO:0006166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006166", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ65", "url": "https://www.uniprot.org/uniprot/Q9CQ65" } ], "pmid": "" }, { "name": "methylation", "id": "GO:0032259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032259", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ65", "url": "https://www.uniprot.org/uniprot/Q9CQ65" } ], "pmid": "" }, { "name": "L-methionine salvage from methylthioadenosine", "id": "GO:0019509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019509", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ65", "url": "https://www.uniprot.org/uniprot/Q9CQ65" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "S-methyl-5-thioadenosine phosphorylase activity", "id": "GO:0017061", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017061", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ65", "url": "https://www.uniprot.org/uniprot/Q9CQ65" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 195, "end_pos": 197, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "11852", "name": "", "equation": "phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0A0G2K583-1", "Q13126-1", "Q8IV20-1", "Q9CQ65-1", "Q8BZT9-1", "Q07938-1", "Q9V813-1" ], "evidence": [ { "id": "11852", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/11852" } ] }, { "id": "R-MMU-1237160", "name": "MTA is cleaved and phosphorylated", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-83951" ], "enzyme_list": [ "Q9CQ65-1" ], "evidence": [ { "id": "R-MMU-1237160", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-1237160" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-83951", "participant_name": "Ade [cytosol]", "crossref": [ { "id": "C00147", "database": "COMPOUND", "url": "" }, { "id": "16708", "database": "ChEBI", "url": "" }, { "id": "HMDB0000034", "database": "HMDB Metabolite", "url": "" }, { "id": "000000000882", "database": "ZINC", "url": "" }, { "id": "4788", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8144939", "database": "PubChem Substance", "url": "" }, { "id": "C00147", "database": "COMPOUND", "url": "" }, { "id": "16708", "database": "ChEBI", "url": "" }, { "id": "HMDB0000034", "database": "HMDB Metabolite", "url": "" }, { "id": "000000000882", "database": "ZINC", "url": "" }, { "id": "4788", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8144939", "database": "PubChem Substance", "url": "" }, { "id": "C00147", "database": "COMPOUND", "url": "" }, { "id": "16708", "database": "ChEBI", "url": "" }, { "id": "HMDB0000034", "database": "HMDB Metabolite", "url": "" }, { "id": "000000000882", "database": "ZINC", "url": "" }, { "id": "4788", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8144939", "database": "PubChem Substance", "url": "" }, { "id": "C00147", "database": "COMPOUND", "url": "" }, { "id": "16708", "database": "ChEBI", "url": "" }, { "id": "HMDB0000034", "database": "HMDB Metabolite", "url": "" }, { "id": "000000000882", "database": "ZINC", "url": "" }, { "id": "4788", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8144939", "database": "PubChem Substance", "url": "" }, { "id": "C00147", "database": "COMPOUND", "url": "" }, { "id": "16708", "database": "ChEBI", "url": "" }, { "id": "HMDB0000034", "database": "HMDB Metabolite", "url": "" }, { "id": "000000000882", "database": "ZINC", "url": "" }, { "id": "4788", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "8144939", "database": "PubChem Substance", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K583", "gene_name": "Mtap", "activity": [ { "ec_number": "2.4.2.28", "activity": "phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate.", "evidence": [ { "id": "A0A0G2K583", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K583" } ] }, { "ec_number": "2.4.2.28", "activity": "", "evidence": [ { "id": "A0A0G2K583", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K583" } ] } ] }, { "uniprot_ac": "Q07938", "gene_name": "MEU1", "activity": [ { "ec_number": "2.4.2.28", "activity": "phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate.", "evidence": [ { "id": "Q07938", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07938" } ] }, { "ec_number": "2.4.2.28", "activity": "", "evidence": [ { "id": "Q07938", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07938" } ] } ] }, { "uniprot_ac": "Q13126", "gene_name": "MTAP", "activity": [ { "ec_number": "2.4.2.28", "activity": "phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate.", "evidence": [ { "id": "Q13126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13126" } ] }, { "ec_number": "2.4.2.28", "activity": "", "evidence": [ { "id": "Q13126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13126" } ] }, { "ec_number": "2.4.2.1", "activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.", "evidence": [ { "id": "Q13126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13126" } ] }, { "ec_number": "2.4.2.1", "activity": "", "evidence": [ { "id": "Q13126", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13126" } ] } ] }, { "uniprot_ac": "Q8BZT9", "gene_name": "Lacc1", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q8BZT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZT9" } ] }, { "ec_number": "2.4.2.1", "activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.", "evidence": [ { "id": "Q8BZT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZT9" } ] }, { "ec_number": "2.4.2.28", "activity": "phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate.", "evidence": [ { "id": "Q8BZT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZT9" } ] }, { "ec_number": "2.4.2.1", "activity": "", "evidence": [ { "id": "Q8BZT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZT9" } ] } ] }, { "uniprot_ac": "Q8IV20", "gene_name": "LACC1", "activity": [ { "ec_number": "3.5.4.4", "activity": "2'-deoxyadenosine + H(+) + H2O = 2'-deoxyinosine + NH4(+).", "evidence": [ { "id": "Q8IV20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IV20" } ] }, { "ec_number": "2.4.2.1", "activity": "a purine 2'-deoxy-D-ribonucleoside + phosphate = 2-deoxy-alpha-D-ribose 1-phosphate + a purine nucleobase.", "evidence": [ { "id": "Q8IV20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IV20" } ] }, { "ec_number": "2.4.2.28", "activity": "phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate.", "evidence": [ { "id": "Q8IV20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IV20" } ] }, { "ec_number": "2.4.2.1", "activity": "", "evidence": [ { "id": "Q8IV20", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IV20" } ] } ] }, { "uniprot_ac": "Q9CQ65", "gene_name": "Mtap", "activity": [ { "ec_number": "2.4.2.28", "activity": "phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate.", "evidence": [ { "id": "Q9CQ65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQ65" } ] }, { "ec_number": "2.4.2.28", "activity": "", "evidence": [ { "id": "Q9CQ65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CQ65" } ] } ] }, { "uniprot_ac": "Q9V813", "gene_name": "Mtap", "activity": [ { "ec_number": "2.4.2.28", "activity": "phosphate + S-methyl-5'-thioadenosine = adenine + S-methyl-5-thio-alpha-D-ribose 1-phosphate.", "evidence": [ { "id": "Q9V813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V813" } ] }, { "ec_number": "2.4.2.28", "activity": "", "evidence": [ { "id": "Q9V813", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V813" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }