{ "uniprot_canonical_ac": "Q9CQ25-1", "uniprot_ac": "Q9CQ25", "uniprot_id": "MZT2_MOUSE", "mass": { "chemical_mass": 16524.0, "monoisotopic_mass": 16524.0 }, "refseq": { "ac": "NP_083630", "name": "mitotic-spindle organizing protein 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083630" }, "gene_names": [ { "name": "Mzt2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CQ25", "id": "Q9CQ25" }, { "name": "2410018G20Rik; 2610001E06Rik; Fam128; Fam128b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083630", "id": "NP_083630" }, { "name": "Fam128b", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9CQ25", "id": "Q9CQ25" }, { "name": "Mozart2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q9CQ25", "id": "Q9CQ25" }, { "name": "Mzt2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083630", "id": "NP_083630" } ], "protein_names": [ { "name": "Mitotic-spindle organizing protein 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CQ25" }, { "name": "Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2B", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CQ25" }, { "name": "mitotic-spindle organizing protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083630", "id": "NP_083630" }, { "name": "mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2; mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2B; family with sequence similarity 128, member B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083630", "id": "NP_083630" } ], "function": [], "disease": [], "snv": [ { "evidence": [ { "id": "rs51015276", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs51015276" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 89, "end_pos": 89, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "16", "chr_pos": "15680318", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S89", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Mzt2", "url": "https://www.uniprot.org/uniprot/Q9CQ25", "locus": { "chromosome": "16", "start_pos": 15666305, "end_pos": 15681233, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000022671", "url": "https://www.ensembl.org/id/ENSMUSG00000022671" } ] } } ], "crossref": [ { "id": "ENSMUSG00000022671", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000022671", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "72083", "url": "https://www.ncbi.nlm.nih.gov/gene/72083", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "Q9CQ25", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9CQ25*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR024332", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024332", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:72083", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72083", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1922845", "url": "http://www.informatics.jax.org/marker/MGI:1922845", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "Q9CQ25", "url": "https://oglcnac.org/atlas/detail/Q9CQ25", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "Q9CQ25", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9CQ25", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "NTKIAVY", "url": "https://omabrowser.org/oma/group/NTKIAVY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3016225at2759", "url": "http://www.orthodb.org/?query=3016225at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR28578", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28578", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28578:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28578:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF12926", "url": "http://pfam.xfam.org/family/PF12926", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CQ25", "url": "http://purl.obolibrary.org/obo/PR_Q9CQ25", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-380270", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-380270", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-MMU-380320", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-380320", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_083630", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_083630", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A2R8VKN7", "url": "https://www.uniprot.org/uniprot/A0A2R8VKN7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8VKN7-1", "url": "https://www.uniprot.org/uniprot/A0A2R8VKN7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CQ25-1", "url": "https://www.uniprot.org/uniprot/Q9CQ25-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAAAAAAGGAALAVSTGLETATLQKLALRRKKVLGAEEMELYELAQAAGAAIDPDVFKILVDLLNLNVAPLAVFQMLKSMCAGQRLASDPQDSVPISLSTSTSETRGRNRGGPILGNVTISAERGSRERPIQRMPRQPSATRLPKVGGSGKSNSRSSP", "length": 159, "header": "sp|Q9CQ25-1|MZT2_MOUSE Isoform 1 of Mitotic-spindle organizing protein 2 OS=Mus musculus OX=10090 GN=Mzt2 PE=1 SV=1 CANONICAL=Q9CQ25-1" }, "isoforms": [ { "isoform_ac": "A0A2R8VKN7-1", "url": "", "sequence": { "sequence": "MAAAAAAAGGAALAVSTGLETATLQKLALRRKKVLGAEEMELYELAQAAGAAIDPDVFKILVDLLNLNVAPLAVFQMLKSMCAGQRLASDPQDSVPISLSTSTSETRGATFRLRRLRRRIGDGLQDEMRTTWKKPRWPHSWQCDHIGRTWKP", "length": 152, "header": "tr|A0A2R8VKN7-1|MZT2_MOUSE Computationally mapped isoform of Mitotic-spindle organizing protein 2 OS=Mus musculus OX=10090 GN=Mzt2 PE=1 SV=1 CANONICAL=Q9CQ25-1" }, "locus": { "chromosome": "16", "start_pos": 15680787, "end_pos": 15666533, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000229680.2", "url": "https://www.ensembl.org/id/ENSMUST00000229680.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000155739.2", "url": "https://www.ensembl.org/id/ENSMUSP00000155739.2" } ] } }, { "isoform_ac": "Q9CQ25-1", "url": "", "sequence": { "sequence": "MAAAAAAAGGAALAVSTGLETATLQKLALRRKKVLGAEEMELYELAQAAGAAIDPDVFKILVDLLNLNVAPLAVFQMLKSMCAGQRLASDPQDSVPISLSTSTSETRGRNRGGPILGNVTISAERGSRERPIQRMPRQPSATRLPKVGGSGKSNSRSSP", "length": 159, "header": "sp|Q9CQ25-1|MZT2_MOUSE Isoform 1 of Mitotic-spindle organizing protein 2 OS=Mus musculus OX=10090 GN=Mzt2 PE=1 SV=1 CANONICAL=Q9CQ25-1" }, "locus": { "chromosome": "16", "start_pos": 15680787, "end_pos": 15666439, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000117136", "url": "https://www.ensembl.org/id/ENSMUST00000117136" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000113832", "url": "https://www.ensembl.org/id/ENSMUSP00000113832" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 102, "start_aa": "Ser", "end_pos": 102, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser102", "evidence": [ { "id": "Q9CQ25", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9CQ25" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 103, "start_aa": "Thr", "end_pos": 103, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr103", "evidence": [ { "id": "Q9CQ25", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q9CQ25" }, { "id": "32848054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 89, "start_aa": "Ser", "end_pos": 89, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser89", "evidence": [ { "id": "Q9CQ25", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9CQ25" }, { "id": "36852467", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36852467" } ] } ], "phosphorylation": [ { "start_pos": 153, "end_pos": 153, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25" } ], "site_lbl": "Ser153" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Systematic analysis of human protein complexes identifies chromosome segregation proteins.", "journal": "Science", "date": "2010", "authors": "Hutchins JR, Toyoda Y, Hegemann B, Poser I, Heriche JK, Sykora MM, Augsburg M, Hudecz O, Buschhorn BA, Bulkescher J, Conrad C, Comartin D, Schleiffer A, Sarov M, Pozniakovsky A, Slabicki MM, Schloissnig S, Steinmacher I, Leuschner M, Ssykor A, Lawo S, Pelletier L, Stark H, Nasmyth K, Ellenberg J, Durbin R, Buchholz F, Mechtler K, Hyman AA, Peters JM", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25" } ], "reference": [ { "type": "PubMed", "id": "20360068", "url": "https://glygen.org/publication/PubMed/20360068" } ] }, { "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", "journal": "Mol. Cell. Proteomics", "date": "2014", "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25" } ], "reference": [ { "type": "PubMed", "id": "24129315", "url": "https://glygen.org/publication/PubMed/24129315" } ] }, { "title": "Age-related loss of neural stem cell O-GlcNAc promotes a glial fate switch through STAT3 activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "White CW 3rd, Fan X, Maynard JC, Wheatley EG, Bieri G, Couthouis J, Burlingame AL, Villeda SA", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "Q9CQ25", "url": "https://oglcnac.org/atlas/detail/Q9CQ25" } ], "reference": [ { "type": "PubMed", "id": "32848054", "url": "https://glygen.org/publication/PubMed/32848054" } ] }, { "title": "Chemoproteomic and Transcriptomic Analysis Reveals that O-GlcNAc Regulates Mouse Embryonic Stem Cell Fate through the Pluripotency Network.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2023-02-27", "authors": "Hao Yi, Li Xiang, Qin Ke, Shi Yujie, He Yanwen, Zhang Che, Cheng Bo, Zhang Xiwen, Hu Guangyu, Liang Shuyu, Tang Qi, Chen Xing", "evidence": [ { "database": "O-GlcNAc Database", "id": "Q9CQ25", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q9CQ25" } ], "reference": [ { "type": "PubMed", "id": "36852467", "url": "https://glygen.org/publication/PubMed/36852467" } ] } ], "pathway": [ { "id": "mmu:72083", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:72083", "resource": "KEGG Pathway" }, { "id": "R-MMU-380270", "name": "Recruitment of mitotic centrosome proteins and complexes", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-380270", "resource": "Reactome", "description": "Recruitment of mitotic centrosome proteins and complexes" }, { "id": "R-MMU-380320", "name": "Recruitment of NuMA to mitotic centrosomes", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-380320", "resource": "Reactome", "description": "Recruitment of NuMA to mitotic centrosomes" } ], "orthologs": [ { "uniprot_canonical_ac": "Q6NZ67-1", "protein_name": "Mitotic-spindle organizing protein 2B", "gene_name": "MZT2B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGAIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRNKGSAALGGALALAERSSREGSSQRMPRQPSATRLPKGGGPGKSPTRGST", "length": 158 }, "evidence": [ { "id": "45238237", "url": "http://www.informatics.jax.org/homology/45238237", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6P582-1", "protein_name": "Mitotic-spindle organizing protein 2A", "gene_name": "MZT2A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAAQGVGPGPGSAAPPGLEAARQKLALRRKKVLSTEEMELYELAQAAGGGIDPDVFKILVDLLKLNVAPLAVFQMLKSMCAGQRLASEPQDPAAVSLPTSSVPETRGRDKGSAALGGVLALAERSNHEGSSQRMPRQPSATRLPKGGGPGKSPTQGST", "length": 158 }, "evidence": [ { "id": "45238237", "url": "http://www.informatics.jax.org/homology/45238237", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25" } ], "pmid": "" }, { "name": "spindle", "id": "GO:0005819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005819", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25" } ], "pmid": "" }, { "name": "gamma-tubulin ring complex", "id": "GO:0000931", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000931", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25" } ], "pmid": "" }, { "name": "microtubule organizing center", "id": "GO:0005815", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005815", "evidence": [ { "database": "UniProtKB", "id": "Q9CQ25", "url": "https://www.uniprot.org/uniprot/Q9CQ25" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 118, "end_pos": 120, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 3 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }