{ "uniprot_canonical_ac": "Q9CPU9-1", "uniprot_ac": "Q9CPU9", "uniprot_id": "COPT2_MOUSE", "mass": { "chemical_mass": 16069.0, "monoisotopic_mass": 16069.0 }, "refseq": { "ac": "NP_001277447", "name": "protein SLC31A2 isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" }, "gene_names": [ { "name": "Slc31a2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q9CPU9", "id": "Q9CPU9" }, { "name": "CTR2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447", "id": "NP_001277447" }, { "name": "Slc31a2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447", "id": "NP_001277447" } ], "protein_names": [ { "name": "Protein SLC31A2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q9CPU9" }, { "name": "CTR2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CPU9" }, { "name": "Copper transporter 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CPU9" }, { "name": "Solute carrier family 31 member 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q9CPU9" }, { "name": "probable low affinity copper uptake protein 2; solute carrier family 31 (copper transporters), member 2; copper transporter 2; protein SLC31A2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447", "id": "NP_001277447" }, { "name": "protein SLC31A2 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447", "id": "NP_001277447" } ], "function": [ { "annotation": "Copper transporter 2 regulates the transport of cisplatin through control of the rate of macropinocytosis. Erratum:[Mol Pharmacol. 2011 May;79(5):894-8]", "evidence": [ { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" }, { "database": "PubMed", "id": "20930109", "url": "https://glygen.org/publication/PubMed/20930109" } ] }, { "annotation": "Ctr2 regulates biogenesis of a cleaved form of mammalian Ctr1 metal transporter lacking the copper- and cisplatin-binding ecto-domain.", "evidence": [ { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" }, { "database": "PubMed", "id": "24167251", "url": "https://glygen.org/publication/PubMed/24167251" } ] }, { "annotation": "Decreased Expression of the Slc31a1 Gene and Cytoplasmic Relocalization of Membrane CTR1 Protein in Renal Epithelial Cells: A Potent Protective Mechanism against Copper Nephrotoxicity in a Mouse Model of Menkes Disease. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" }, { "database": "PubMed", "id": "36232742", "url": "https://glygen.org/publication/PubMed/36232742" } ] }, { "annotation": "Does not function as a copper(1+) importer in vivo (PubMed:24167251). However, in vitro functions as low-affinity copper(1+) importer (By similarity). Regulator of SLC31A1 which facilitates the cleavage of the SLC31A1 ecto-domain or which stabilizes the truncated form of SLC31A1 (Truncated CTR1 form), thereby drives the SLC31A1 truncated form-dependent endosomal copper export and modulates the copper and cisplatin accumulation via SLC31A1 (PubMed:24167251).", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9#function" }, { "database": "UniProtKB", "id": "O15432", "url": "https://www.uniprot.org/uniprot/O15432#function" }, { "database": "PubMed", "id": "24167251", "url": "https://glygen.org/publication/PubMed/24167251" } ] }, { "annotation": "Gene duplication and neo-functionalization in the evolutionary and functional divergence of the metazoan copper transporters Ctr1 and Ctr2", "evidence": [ { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" }, { "database": "PubMed", "id": "28507097", "url": "https://glygen.org/publication/PubMed/28507097" } ] }, { "annotation": "In mouse embryo fibroblasts, reduction of CTR1 expression renders cells resistant to cisplatin whereas reduction of CTR2 makes them hypersensitive both in vitro and in vivo.", "evidence": [ { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" }, { "database": "PubMed", "id": "24522273", "url": "https://glygen.org/publication/PubMed/24522273" } ] }, { "annotation": "The increase in granular staining and heparin content is compatible with an impact of Ctr2 on mast cell maturation and, in support of this, the absence of Ctr2 resulted in markedly increased mRNA expression, storage, and enzymatic activity of tryptase.", "evidence": [ { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" }, { "database": "PubMed", "id": "26342034", "url": "https://glygen.org/publication/PubMed/26342034" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Slc31a2", "url": "https://www.uniprot.org/uniprot/Q9CPU9", "locus": { "chromosome": "4", "start_pos": 62216648, "end_pos": 62180799, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000066152", "url": "https://www.ensembl.org/id/ENSMUSG00000066152" } ] } } ], "crossref": [ { "id": "ENSMUSG00000066152", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000066152", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "20530", "url": "https://www.ncbi.nlm.nih.gov/gene/20530", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007274", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007274", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:20530", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:20530", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1333844", "url": "http://www.informatics.jax.org/marker/MGI:1333844", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "QTLFHVV", "url": "https://omabrowser.org/oma/group/QTLFHVV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2911172at2759", "url": "http://www.orthodb.org/?query=2911172at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12483", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12483", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12483:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12483:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04145", "url": "http://pfam.xfam.org/family/PF04145", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q9CPU9", "url": "http://purl.obolibrary.org/obo/PR_Q9CPU9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9CPU9-1", "url": "https://www.uniprot.org/uniprot/Q9CPU9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D524", "url": "https://www.uniprot.org/uniprot/Q9D524", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9D524-1", "url": "https://www.uniprot.org/uniprot/Q9D524-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPMHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVIQVVIGYFVMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLNMT", "length": 143, "header": "sp|Q9CPU9-1|COPT2_MOUSE Isoform 1 of Protein SLC31A2 OS=Mus musculus OX=10090 GN=Slc31a2 PE=1 SV=1 CANONICAL=Q9CPU9-1" }, "isoforms": [ { "isoform_ac": "Q9CPU9-1", "url": "", "sequence": { "sequence": "MPMHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVIQVVIGYFVMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLNMT", "length": 143, "header": "sp|Q9CPU9-1|COPT2_MOUSE Isoform 1 of Protein SLC31A2 OS=Mus musculus OX=10090 GN=Slc31a2 PE=1 SV=1 CANONICAL=Q9CPU9-1" }, "locus": { "chromosome": "4", "start_pos": 62215377, "end_pos": 62204806, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000084530", "url": "https://www.ensembl.org/id/ENSMUST00000084530" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000081578", "url": "https://www.ensembl.org/id/ENSMUSP00000081578" } ] } }, { "isoform_ac": "Q9D524-1", "url": "", "sequence": { "sequence": "MHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPATNSQQFILGPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVIQVVIGYFVMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLNMT", "length": 141, "header": "tr|Q9D524-1|Q9D524_MOUSE Computationally mapped isoform of Copper transport protein OS=Mus musculus OX=10090 GN=Slc31a2 PE=1 SV=1 CANONICAL=Q9CPU9-1" }, "locus": { "chromosome": "4", "start_pos": 62215377, "end_pos": 62210869, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000107468.8", "url": "https://www.ensembl.org/id/ENSMUST00000107468.8" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000103092.2", "url": "https://www.ensembl.org/id/ENSMUSP00000103092.2" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "Q9CPU9", "url": "http://phospho.elm.eu.org/byAccession/Q9CPU9.html" }, { "database": "iPTMnet", "id": "Q9CPU9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9CPU9" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ], "site_lbl": "Ser63" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "phospho.ELM", "id": "Q9CPU9", "url": "http://phospho.elm.eu.org/byAccession/Q9CPU9.html" }, { "database": "iPTMnet", "id": "Q9CPU9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9CPU9" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ], "site_lbl": "Thr75" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" }, { "database": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" }, { "database": "iPTMnet", "id": "Q9CPU9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9CPU9" } ], "site_lbl": "Ser77" } ], "glycation": [], "keywords": [], "publication": [ { "title": "The phagosomal proteome in interferon-gamma-activated macrophages.", "journal": "Immunity", "date": "2009", "authors": "Trost M, English L, Lemieux S, Courcelles M, Desjardins M, Thibault P", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" }, { "database": "UniProtKB", "id": "Q9D524", "url": "https://www.uniprot.org/uniprot/Q9D524" }, { "database": "iPTMnet", "id": "Q9CPU9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9CPU9" } ], "reference": [ { "type": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ] }, { "title": "Copper transporter 2 regulates endocytosis and controls tumor growth and sensitivity to cisplatin in vivo.", "journal": "Molecular pharmacology", "date": "2011", "authors": "Blair BG, Larson CA, Adams PL, Abada PB, Pesce CE, Safaei R, Howell SB", "evidence": [ { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" } ], "reference": [ { "type": "PubMed", "id": "20930109", "url": "https://glygen.org/publication/PubMed/20930109" } ] }, { "title": "A tissue-specific atlas of mouse protein phosphorylation and expression.", "journal": "Cell", "date": "2010", "authors": "Huttlin EL, Jedrychowski MP, Elias JE, Goswami T, Rad R, Beausoleil SA, Villen J, Haas W, Sowa ME, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" }, { "database": "iPTMnet", "id": "Q9CPU9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9CPU9" } ], "reference": [ { "type": "PubMed", "id": "21183079", "url": "https://glygen.org/publication/PubMed/21183079" } ] }, { "title": "Ctr2 regulates biogenesis of a cleaved form of mammalian Ctr1 metal transporter lacking the copper- and cisplatin-binding ecto-domain.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2013", "authors": "Ohrvik H, Nose Y, Wood LK, Kim BE, Gleber SC, Ralle M, Thiele DJ", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" }, { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" } ], "reference": [ { "type": "PubMed", "id": "24167251", "url": "https://glygen.org/publication/PubMed/24167251" } ] }, { "title": "Copper transporter 2 regulates intracellular copper and sensitivity to cisplatin.", "journal": "Metallomics : integrated biometal science", "date": "2014", "authors": "Huang CP, Fofana M, Chan J, Chang CJ, Howell SB", "evidence": [ { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" } ], "reference": [ { "type": "PubMed", "id": "24522273", "url": "https://glygen.org/publication/PubMed/24522273" } ] }, { "title": "Ctr2 Regulates Mast Cell Maturation by Affecting the Storage and Expression of Tryptase and Proteoglycans.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2015", "authors": "Ohrvik H, Logeman B, Noguchi G, Eriksson I, Kjellen L, Thiele DJ, Pejler G", "evidence": [ { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" } ], "reference": [ { "type": "PubMed", "id": "26342034", "url": "https://glygen.org/publication/PubMed/26342034" } ] }, { "title": "Gene duplication and neo-functionalization in the evolutionary and functional divergence of the metazoan copper transporters Ctr1 and Ctr2.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Logeman BL, Wood LK, Lee J, Thiele DJ", "evidence": [ { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" } ], "reference": [ { "type": "PubMed", "id": "28507097", "url": "https://glygen.org/publication/PubMed/28507097" } ] }, { "title": "Decreased Expression of the Slc31a1 Gene and Cytoplasmic Relocalization of Membrane CTR1 Protein in Renal Epithelial Cells: A Potent Protective Mechanism against Copper Nephrotoxicity in a Mouse Model of Menkes Disease.", "journal": "International journal of molecular sciences", "date": "2022-09-28", "authors": "Haberkiewicz Olga, Lipi\u0144ski Pawe\u0142, Starzy\u0144ski Rafa\u0142 R, Jo\u0144czy Aneta, Kurowska Patrycja, Og\u00f3rek Mateusz, Bednarz Aleksandra, Herman Sylwia, Hatala Dawid, Grzmil Pawe\u0142, Rajfur Zenon, Baster Zbigniew, Lenartowicz Ma\u0142gorzata", "evidence": [ { "database": "RefSeq", "id": "NP_001277447", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001277447" } ], "reference": [ { "type": "PubMed", "id": "36232742", "url": "https://glygen.org/publication/PubMed/36232742" } ] } ], "pathway": [ { "id": "mmu:20530", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:20530", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "D4AAE7-1", "protein_name": "Copper transport protein", "gene_name": "Slc31a2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPMHFIFSDEAVLLFDFWRVHSPTGMALSVLVVLLLAVLYEGIKVGKAKLLHKTLESLPTTTSQQLILEPDQDSTGSRSTSDNRTRLRWFLCYFGQSLVHVIQVVIGYFVMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLHMT", "length": 143 }, "evidence": [ { "id": "45230054", "url": "http://www.informatics.jax.org/homology/45230054", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O15432-1", "protein_name": "Protein SLC31A2", "gene_name": "SLC31A2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLCHFGQSLIHVIQVVIGYFIMLAVMSYNTWIFLGVVLGSAVGYYLAYPLLSTA", "length": 143 }, "evidence": [ { "id": "45230054", "url": "http://www.informatics.jax.org/homology/45230054", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "intracellular copper ion homeostasis", "id": "GO:0006878", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006878", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" }, { "name": "copper ion transport", "id": "GO:0006825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006825", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" }, { "name": "copper ion import", "id": "GO:0015677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015677", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" }, { "name": "regulation of copper ion transmembrane transport", "id": "GO:1902311", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902311", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" }, { "name": "recycling endosome", "id": "GO:0055037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055037", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" }, { "name": "recycling endosome membrane", "id": "GO:0055038", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055038", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" }, { "name": "late endosome", "id": "GO:0005770", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005770", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "copper ion transmembrane transporter activity", "id": "GO:0005375", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005375", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 141, "end_pos": 143, "annotation": "n_glycosylation_sequon" }, { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Ubiquitinated; ubiquitination and the subsequent proteasomal degradation are prevent by SLC31A1 that stabilizes it.", "evidence": [ { "database": "UniProtKB", "id": "Q9CPU9", "url": "https://www.uniprot.org/uniprot/Q9CPU9" }, { "database": "PubMed", "id": "O15432", "url": "https://glygen.org/publication/PubMed/O15432" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }