{ "uniprot_canonical_ac": "Q99P91-1", "uniprot_ac": "Q99P91", "uniprot_id": "GPNMB_MOUSE", "mass": { "chemical_mass": 63676.0, "monoisotopic_mass": 63676.0 }, "refseq": { "ac": "NP_444340", "name": "transmembrane glycoprotein NMB precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340" }, "gene_names": [ { "name": "Gpnmb", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q99P91", "id": "Q99P91" }, { "name": "DC-HIL; Dchil; ipd", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340", "id": "NP_444340" }, { "name": "Dchil", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q99P91", "id": "Q99P91" }, { "name": "Gpnmb", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340", "id": "NP_444340" }, { "name": "Hgfin", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q99P91", "id": "Q99P91" }, { "name": "Nmb", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q99P91", "id": "Q99P91" } ], "protein_names": [ { "name": "Transmembrane glycoprotein NMB", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q99P91" }, { "name": "DC-HIL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99P91" }, { "name": "Dendritic cell-associated transmembrane protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99P91" }, { "name": "Osteoactivin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99P91" }, { "name": "dendritic cell-associated heparin sulfate proteoglycan-dependent integrin ligand; transmembrane glycoprotein NMB; osteoactivin; dendritic cell-associated transmembrane protein; iris pigment dispersion", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340", "id": "NP_444340" }, { "name": "transmembrane glycoprotein NMB precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340", "id": "NP_444340" } ], "function": [ { "annotation": "Could be a melanogenic enzyme.", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91#function" } ] }, { "annotation": "Glycoprotein nonmetastatic melanoma protein B regulates lysosomal integrity and lifespan of senescent cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_444340", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340" }, { "database": "PubMed", "id": "35444208", "url": "https://glygen.org/publication/PubMed/35444208" } ] }, { "annotation": "Role of Gpnmb in atherosclerosis of female mice.", "evidence": [ { "database": "RefSeq", "id": "NP_444340", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340" }, { "database": "PubMed", "id": "35809343", "url": "https://glygen.org/publication/PubMed/35809343" } ] }, { "annotation": "Single-cell transcriptome sequencing-based analysis: probing the mechanisms of glycoprotein NMB regulation of epithelial cells involved in silicosis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_444340", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340" }, { "database": "PubMed", "id": "37468937", "url": "https://glygen.org/publication/PubMed/37468937" } ] }, { "annotation": "Tumor endothelial cell-induced CD8(+) T-cell exhaustion via GPNMB in hepatocellular carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_444340", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340" }, { "database": "PubMed", "id": "35289033", "url": "https://glygen.org/publication/PubMed/35289033" } ] } ], "disease": [ { "disease_id": "DOID:0060680", "recommended_name": { "id": "DOID:0060680", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060680", "name": "pigment dispersion syndrome", "description": "An eye disease characterized by slit-like depigmented areas of the iris with up to 50% of patients going on to develop glaucoma." }, "synonyms": [ { "id": "DOID:0060680", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060680", "name": "glaucoma-related pigment dispersion syndrome", "description": "" }, { "id": "DOID:0060680", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0060680", "name": "pigment-dispersion type glaucoma", "description": "" }, { "id": "MONDO:0010896", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010896", "name": "pigment dispersion syndrome", "description": "Pigment-dispersion syndrome is an eye disorder that occurs when pigment granules that normally adhere to the back of the iris (the colored part of the eye) flake off into the clear fluid produced by the eye (aqueous humor). These pigment granules may flow towards the drainage canals of the eye, slowly clogging them and raising the pressure within the eye (intraocular pressure or IOP). This rise in eye pressure can cause damage to the optic nerve (the nerve in the back of the eye that carries visual images to the brain). If the optic nerve becomes damaged, pigment-dispersion syndrome becomes pigmentary glaucoma. This happens in about 30% of cases. Pigment-dispersion syndrome commonly presents between the second and fourth decades, which is earlier than other types of glaucoma. While men and women are affected in equal numbers, men develop pigmentary glaucoma up to 3 times more often than women. Myopia (nearsightedness) appears to be an important risk factor in the development of pigment-dispersion syndrome and is present in up to 80% of affected individuals. The condition may be sporadic or follow an autosomal dominant pattern of inheritance with reduced penetrance. At least one gene locus on chromosome 7 has been identified. Pigment-dispersion syndrome can be treated with eye drops or other medications. In some cases, laser surgery may be performed." }, { "id": "MONDO:0010896", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010896", "name": "glaucoma-related pigment dispersion syndrome", "description": "" }, { "id": "MONDO:0010896", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010896", "name": "pigment dispersion syndrome", "description": "" }, { "id": "MONDO:0010896", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010896", "name": "pigment-dispersion type glaucoma", "description": "" }, { "id": "MONDO:0010896", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010896", "name": "GPDS1", "description": "" }, { "id": "MONDO:0010896", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010896", "name": "glaucoma, pigment-dispersion type", "description": "" }, { "id": "MONDO:0010896", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010896", "name": "glaucoma-RELATED pigment dispersion syndrome", "description": "" }, { "id": "MONDO:0010896", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010896", "name": "pigment-dispersion syndrome", "description": "" } ], "evidence": [ { "id": "0060680", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0060680" } ] }, { "disease_id": "DOID:0080932", "recommended_name": { "id": "DOID:0080932", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080932", "name": "primary localized cutaneous amyloidosis 3", "description": "A primary cutaneous amyloidosis that is characterized by deposits of keratinocyte-derived amyloid in the skin and that has_material_basis_in homozygous or compound heterozygous mutation in the GPNMB gene on chromosome 7p15. Onset occurs before puberty and involves macular or reticulate hyperpigmentation admixed with symmetrically distributed guttate hypopigmented and hyperpigmented lesions." }, "synonyms": [ { "id": "DOID:0080932", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080932", "name": "Amyloidosis cutis dyschromica", "description": "" }, { "id": "MONDO:0054765", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0054765", "name": "amyloidosis, primary localized cutaneous, 3", "description": "" }, { "id": "MONDO:0054765", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0054765", "name": "PLCA3", "description": "" }, { "id": "MONDO:0054765", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0054765", "name": "amyloidosis cutis dyschromica", "description": "" }, { "id": "MONDO:0054765", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0054765", "name": "amyloidosis, PRIMARY LOCALIZED cutaneous, 3", "description": "" }, { "id": "MIM:617920", "resource": "MIM", "url": "https://www.omim.org/entry/617920", "name": "Amyloidosis, primary localized cutaneous, 3", "description": "Amyloidosis, primary localized cutaneous, 3" } ], "evidence": [ { "id": "0080932", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:0080932" } ] }, { "disease_id": "DOID:3454", "recommended_name": { "id": "DOID:3454", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3454", "name": "brain infarction", "description": "A cerebrovascular disease that is characterized by tissue necrosis located_in the brain, resulting from inadequate blood flow through the brain." }, "synonyms": [], "evidence": [ { "id": "3454", "database": "Alliance of Genome Resources", "url": "https://www.alliancegenome.org/disease/DOID:3454" } ] } ], "snv": [ { "evidence": [ { "id": "rs3396794548", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3396794548" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 134, "end_pos": 134, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NWT->SWT).", "chr_id": "6", "chr_pos": "49022272", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N134", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3388823297", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388823297" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 249, "end_pos": 249, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->ILS).", "chr_id": "6", "chr_pos": "49024715", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N249", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs3388830386", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs3388830386" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 312, "end_pos": 312, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->HLT).", "chr_id": "6", "chr_pos": "49024903", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N312", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Mus musculus", "taxid": 10090, "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "common_name": "Mouse" } ], "gene": [ { "name": "Gpnmb", "url": "https://www.uniprot.org/uniprot/Q99P91", "locus": { "chromosome": "6", "start_pos": 49047863, "end_pos": 49013480, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSMUSG00000029816", "url": "https://www.ensembl.org/id/ENSMUSG00000029816" } ] } } ], "crossref": [ { "id": "ENSMUSG00000029816", "url": "https://bgee.org/?page=gene&gene_id=ENSMUSG00000029816", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00146", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00146", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "93695", "url": "https://www.ncbi.nlm.nih.gov/gene/93695", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "GPDB0006399", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0006399", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "GPDB0007266", "url": "https://acgg.asia/db/gpdb/symbol/GPDB0007266", "database": "GlycoProtDB", "categories": [ "Glycoproteomics" ] }, { "id": "Q99P91", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q99P91*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000601", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000601", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022409", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022409", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035986", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035986", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045219", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045219", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046846", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046846", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "mmu:93695", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:93695", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "1934765", "url": "http://www.informatics.jax.org/marker/MGI:1934765", "database": "MGI", "categories": [ "Organism-specific" ] }, { "id": "HGWRKWN", "url": "https://omabrowser.org/oma/group/HGWRKWN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5359029at2759", "url": "http://www.orthodb.org/?query=5359029at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11861", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11861", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11861:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11861:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00801", "url": "http://pfam.xfam.org/family/PF00801", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF20433", "url": "http://pfam.xfam.org/family/PF20433", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q99P91", "url": "http://purl.obolibrary.org/obo/PR_Q99P91", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-MMU-8857538", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8857538", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_444340", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0N4SVG5", "url": "https://www.uniprot.org/uniprot/A0A0N4SVG5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0N4SVG5-1", "url": "https://www.uniprot.org/uniprot/A0A0N4SVG5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BVA0", "url": "https://www.uniprot.org/uniprot/Q8BVA0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q8BVA0-1", "url": "https://www.uniprot.org/uniprot/Q8BVA0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q99P91-1", "url": "https://www.uniprot.org/uniprot/Q99P91-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESLCGVLGFLLLAAGLPLQAAKRFRDVLGHEQYPDHMREHNQLRGWSSDENEWDEHLYPVWRRGDGRWKDSWEGGRVQAVLTSDSPALVGSNITFVVNLVFPRCQKEDANGNIVYEKNCRNDLGLTSDLHVYNWTAGADDGDWEDGTSRSQHLRFPDRRPFPRPHGWKKWSFVYVFHTLGQYFQKLGRCSARVSINTVNLTAGPQVMEVTVFRRYGRAYIPISKVKDVYVITDQIPVFVTMSQKNDRNLSDEIFLRDLPIVFDVLIHDPSHFLNDSAISYKWNFGDNTGLFVSNNHTLNHTYVLNGTFNLNLTVQTAVPGPCPPPSPSTPPPPSTPPSPPPSPLPTLSTPSPSLMPTGYKSMELSDISNENCRINRYGYFRATITIVEGILEVSIMQIADVPMPTPQPANSLMDFTVTCKGATPMEACTIISDPTCQIAQNRVCSPVAVDGLCLLSVRRAFNGSGTYCVNFTLGDDASLALTSTLISIPGKDPDSPLRAVNGVLISIGCLAVLVTMVTILLYKKHKAYKPIGNCPRNTVKGKGLSVLLSHAKAPFFRGDQEKDPLLQDKPRTL", "length": 574, "header": "sp|Q99P91-1|GPNMB_MOUSE Isoform 1 of Transmembrane glycoprotein NMB OS=Mus musculus OX=10090 GN=Gpnmb PE=1 SV=2 CANONICAL=Q99P91-1" }, "isoforms": [ { "isoform_ac": "A0A0N4SVG5-1", "url": "", "sequence": { "sequence": "MESLCGVLGFLLLAAGLPLQAAKQGRAHMCGGQWTSL", "length": 37, "header": "tr|A0A0N4SVG5-1|A0A0N4SVG5_MOUSE Computationally mapped isoform of Glycoprotein (transmembrane) nmb OS=Mus musculus OX=10090 GN=Gpnmb PE=4 SV=1 CANONICAL=Q99P91-1" }, "locus": { "chromosome": "6", "start_pos": 49019243, "end_pos": 49013657, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000203757.2", "url": "https://www.ensembl.org/id/ENSMUST00000203757.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000145090.2", "url": "https://www.ensembl.org/id/ENSMUSP00000145090.2" } ] } }, { "isoform_ac": "Q8BVA0-1", "url": "", "sequence": { "sequence": "MESLCGVLGFLLLAAGLPLQAAKRFRDVLGHEQYPDHMREHNQLRGWSSDENEWDEHLYPVWRRGDGRWKDSWEGGRVQAVLTSDSPALVGSNITFVVNLVFPRCQKEDANGNIVYEKNCRNDLGLTSDLHVYNWTAGADDGDWEDGTSRSQHLRFPDRRPFPRPHGWKKWSFVYVFHTLGQYFQKLGRCSARVSINTVNLTAGPQVMEVTVFRRYGRAYIPISKVKDVYVITDQIPVFVTMSQKNDRNLSDEIFLRDLPIVFDVLIHDPSHFLNDSAISYKWNFGDNTGLFVSNNHTLNHTYVLNGTFNLNLTVQTAVPGPCPPPSPSTPPPPSTPPSPPPSPLPTLSTPSPSLMPTGYKSMELSDISNENCRINRYGYFRATITIVEGILEVSIMQIADVPMPTPQPANSLMDFTVTCKGATPMEACTIISDPTCQIAQNRVCSPVAVDGLCLLSVRRAFNGSGTYCVNFTLGDDASLALTSTLISIPGKDPDSPLRAVNGVLISIGCLAVLVTMVTILLYNLG", "length": 526, "header": "tr|Q8BVA0-1|GPNMB_MOUSE Computationally mapped isoform of Transmembrane glycoprotein NMB OS=Mus musculus OX=10090 GN=Gpnmb PE=1 SV=1 CANONICAL=Q99P91-1" }, "locus": { "chromosome": "6", "start_pos": 49047057, "end_pos": 49013657, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000204260.2", "url": "https://www.ensembl.org/id/ENSMUST00000204260.2" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000145376.2", "url": "https://www.ensembl.org/id/ENSMUSP00000145376.2" } ] } }, { "isoform_ac": "Q99P91-1", "url": "", "sequence": { "sequence": "MESLCGVLGFLLLAAGLPLQAAKRFRDVLGHEQYPDHMREHNQLRGWSSDENEWDEHLYPVWRRGDGRWKDSWEGGRVQAVLTSDSPALVGSNITFVVNLVFPRCQKEDANGNIVYEKNCRNDLGLTSDLHVYNWTAGADDGDWEDGTSRSQHLRFPDRRPFPRPHGWKKWSFVYVFHTLGQYFQKLGRCSARVSINTVNLTAGPQVMEVTVFRRYGRAYIPISKVKDVYVITDQIPVFVTMSQKNDRNLSDEIFLRDLPIVFDVLIHDPSHFLNDSAISYKWNFGDNTGLFVSNNHTLNHTYVLNGTFNLNLTVQTAVPGPCPPPSPSTPPPPSTPPSPPPSPLPTLSTPSPSLMPTGYKSMELSDISNENCRINRYGYFRATITIVEGILEVSIMQIADVPMPTPQPANSLMDFTVTCKGATPMEACTIISDPTCQIAQNRVCSPVAVDGLCLLSVRRAFNGSGTYCVNFTLGDDASLALTSTLISIPGKDPDSPLRAVNGVLISIGCLAVLVTMVTILLYKKHKAYKPIGNCPRNTVKGKGLSVLLSHAKAPFFRGDQEKDPLLQDKPRTL", "length": 574, "header": "sp|Q99P91-1|GPNMB_MOUSE Isoform 1 of Transmembrane glycoprotein NMB OS=Mus musculus OX=10090 GN=Gpnmb PE=1 SV=2 CANONICAL=Q99P91-1" }, "locus": { "chromosome": "6", "start_pos": 49033245, "end_pos": 49013657, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSMUST00000031840", "url": "https://www.ensembl.org/id/ENSMUST00000031840" }, { "database": "Ensembl Peptide", "id": "ENSMUSP00000031840", "url": "https://www.ensembl.org/id/ENSMUSP00000031840" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 134, "start_aa": "Asn", "end_pos": 134, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn134", "evidence": [ { "id": "Q99P91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P91#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 200, "start_aa": "Asn", "end_pos": 200, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn200", "evidence": [ { "id": "Q99P91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P91#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 249, "start_aa": "Asn", "end_pos": 249, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn249", "evidence": [ { "id": "Q99P91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P91#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "Q99P91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P91#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "Q99P91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P91#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 300, "start_aa": "Asn", "end_pos": 300, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn300", "evidence": [ { "id": "Q99P91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P91#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 306, "start_aa": "Asn", "end_pos": 306, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn306", "evidence": [ { "id": "Q99P91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P91#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 312, "start_aa": "Asn", "end_pos": 312, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn312", "evidence": [ { "id": "Q99P91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P91#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 463, "start_aa": "Asn", "end_pos": 463, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn463", "evidence": [ { "id": "Q99P91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P91#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 471, "start_aa": "Asn", "end_pos": 471, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn471", "evidence": [ { "id": "Q99P91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P91#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "Q99P91", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P91#ptm_processing" } ] } ], "phosphorylation": [ { "start_pos": 546, "end_pos": 546, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" }, { "database": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" }, { "database": "phospho.ELM", "id": "Q99P91", "url": "http://phospho.elm.eu.org/byAccession/Q99P91.html" }, { "database": "iPTMnet", "id": "Q99P91", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99P91" } ], "site_lbl": "Ser546" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Molecular cloning of a dendritic cell-associated transmembrane protein, DC-HIL, that promotes RGD-dependent adhesion of endothelial cells through recognition of heparan sulfate proteoglycans.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Ariizumi K., Bonkobara M., Shikano S., Zukas P.K.", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "reference": [ { "type": "PubMed", "id": "11114299", "url": "https://glygen.org/publication/PubMed/11114299" } ] }, { "title": "mRNA expression of the murine glycoprotein (transmembrane) nmb (Gpnmb) gene is linked to the developing retinal pigment epithelium and iris.", "journal": "Gene Expr. Patterns", "date": "2002", "authors": "Bachner D, Schroder D, Gross G", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "reference": [ { "type": "PubMed", "id": "12638126", "url": "https://glygen.org/publication/PubMed/12638126" } ] }, { "title": "Osteoactivin promotes breast cancer metastasis to bone.", "journal": "Mol. Cancer Res.", "date": "2007", "authors": "Russo C., Hallett M., Abou Khalil J.E., Pepin F., Rose A.A., Siegel P.M.", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "reference": [ { "type": "PubMed", "id": "17951401", "url": "https://glygen.org/publication/PubMed/17951401" } ] }, { "title": "The phagosomal proteome in interferon-gamma-activated macrophages.", "journal": "Immunity", "date": "2009", "authors": "Trost M, English L, Lemieux S, Courcelles M, Desjardins M, Thibault P", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" }, { "database": "iPTMnet", "id": "Q99P91", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99P91" } ], "reference": [ { "type": "PubMed", "id": "19144319", "url": "https://glygen.org/publication/PubMed/19144319" } ] }, { "title": "Tumor endothelial cell-induced CD8(+) T-cell exhaustion via GPNMB in hepatocellular carcinoma.", "journal": "Cancer science", "date": "2022", "authors": "Sakano Y, Noda T, Kobayashi S, Sasaki K, Iwagami Y, Yamada D, Tomimaru Y, Akita H, Gotoh K, Takahashi H, Asaoka T, Tanemura M, Wada H, Doki Y, Eguchi H", "evidence": [ { "database": "RefSeq", "id": "NP_444340", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340" } ], "reference": [ { "type": "PubMed", "id": "35289033", "url": "https://glygen.org/publication/PubMed/35289033" } ] }, { "title": "Glycoprotein nonmetastatic melanoma protein B regulates lysosomal integrity and lifespan of senescent cells.", "journal": "Scientific reports", "date": "2022", "authors": "Suda M, Shimizu I, Katsuumi G, Hsiao CL, Yoshida Y, Matsumoto N, Yoshida Y, Katayama A, Wada J, Seki M, Suzuki Y, Okuda S, Ozaki K, Nakanishi-Matsui M, Minamino T", "evidence": [ { "database": "RefSeq", "id": "NP_444340", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340" } ], "reference": [ { "type": "PubMed", "id": "35444208", "url": "https://glygen.org/publication/PubMed/35444208" } ] }, { "title": "Role of Gpnmb in atherosclerosis of female mice.", "journal": "Biochemical and biophysical research communications", "date": "2022", "authors": "Nickl B, Qadri F, Bader M", "evidence": [ { "database": "RefSeq", "id": "NP_444340", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340" } ], "reference": [ { "type": "PubMed", "id": "35809343", "url": "https://glygen.org/publication/PubMed/35809343" } ] }, { "title": "Single-cell transcriptome sequencing-based analysis: probing the mechanisms of glycoprotein NMB regulation of epithelial cells involved in silicosis.", "journal": "Particle and fibre toxicology", "date": "2023-07-19", "authors": "Yang Shaoqi, Sun Yuheng, Long Min, Zhou Xinbei, Yuan Mengqin, Yang Liliang, Luo Wei, Cheng Yusi, Zhang Xinxin, Jiang Wei, Chao Jie", "evidence": [ { "database": "RefSeq", "id": "NP_444340", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_444340" } ], "reference": [ { "type": "PubMed", "id": "37468937", "url": "https://glygen.org/publication/PubMed/37468937" } ] } ], "pathway": [ { "id": "mmu:93695", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+mmu:93695", "resource": "KEGG Pathway" }, { "id": "R-MMU-8857538", "name": "PTK6 promotes HIF1A stabilization", "url": "https://www.reactome.org/PathwayBrowser/#R-MMU-8857538", "resource": "Reactome", "description": "PTK6 promotes HIF1A stabilization" } ], "orthologs": [ { "uniprot_canonical_ac": "Q14956-1", "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "GPNMB", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MECLYYFLGFLLLAARLPLDAAKRFHDVLGNERPSAYMREHNQLNGWSSDENDWNEKLYPVWKRGDMRWKNSWKGGRVQAVLTSDSPALVGSNITFAVNLIFPRCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAWSEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNFIYVFHTLGQYFQKLGRCSVRVSVNTANVTLGPQLMEVTVYRRHGRAYVPIAQVKDVYVVTDQIPVFVTMFQKNDRNSSDETFLKDLPIMFDVLIHDPSHFLNYSTINYKWSFGDNTGLFVSTNHTVNHTYVLNGTFSLNLTVKAAAPGPCPPPPPPPRPSKPTPSLATTLKSYDSNTPGPAGDNPLELSRIPDENCQINRYGHFQATITIVEGILEVNIIQMTDVLMPVPWPESSLIDFVVTCQGSIPTEVCTIISDPTCEITQNTVCSPVDVDEMCLLTVRRTFNGSGTYCVNLTLGDDTSLALTSTLISVPDRDPASPLRMANSALISVGCLAIFVTVISLLVYKKHKEYNPIENSPGNVVRSKGLSVFLNRAKAVFFPGNQEKDPLLKNQEFKGVS", "length": 572 }, "evidence": [ { "id": "45235313", "url": "http://www.informatics.jax.org/homology/45235313", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6P7C7-1", "protein_name": "Transmembrane glycoprotein NMB", "gene_name": "Gpnmb", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MESLCGVLVFLLLAAGLPLQAAKRFRDVLGHEQYPDHMRENNQLRGWSSDENEWDEQLYPVWRRGEGRWKDSWEGGRVQAALTSDSPALVGSNITFVVNLVFPRCQKEDANGNIVYERNCRSDLELASDPYVYNWTTGADDEDWEDSTSQGQHLRFPDGKPFPRPHGRKKWNFVYVFHTLGQYFQKLGRCSARVSINTVNLTVGPQVMEVIVFRRHGRAYIPISKVKDVYVITDQIPIFVTMYQKNDRNSSDETFLRDLPIFFDVLIHDPSHFLNYSAISYKWNFGDNTGLFVSNNHTLNHTYVLNGTFNFNLTVQTAVPGPCPSPTPSPSSSTSPSPASSPSPTLSTPSPSLMPTGHKSMELSDISNENCRINRYGYFRATITIVDGILEVNIIQVADVPIPTPQPDNSLMDFIVTCKGATPTEACTIISDPTCQIAQNRVCSPVAVDELCLLSVRRAFNGSGTYCVNFTLGDDASLALTSALISIPGKDLGSPLRTVNGVLISIGCLAMFVTMVTILLYKKHKTYKPIGNCTRNVVKGKGLSVFLSHAKAPFSRGDREKDPLLQDKPWML", "length": 572 }, "evidence": [ { "id": "Q99P91", "url": "https://omabrowser.org/oma/group/Q99P91/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "positive regulation of protein phosphorylation", "id": "GO:0001934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001934", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "cell-cell signaling", "id": "GO:0007267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007267", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "negative regulation of neuron death", "id": "GO:1901215", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901215", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "negative regulation of tumor necrosis factor production", "id": "GO:0032720", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032720", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "negative regulation of T cell proliferation", "id": "GO:0042130", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042130", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "osteoblast differentiation", "id": "GO:0001649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001649", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "negative regulation of G1/S transition of mitotic cell cycle", "id": "GO:2000134", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000134", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "bone mineralization", "id": "GO:0030282", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030282", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "positive regulation of protein autophosphorylation", "id": "GO:0031954", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031954", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "negative regulation of T cell activation", "id": "GO:0050868", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050868", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "regulation of tissue remodeling", "id": "GO:0034103", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034103", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "negative regulation of cytokine production", "id": "GO:0001818", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001818", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "integrin binding", "id": "GO:0005178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "receptor ligand activity", "id": "GO:0048018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048018", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "syndecan binding", "id": "GO:0045545", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045545", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "early endosome membrane", "id": "GO:0031901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031901", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" }, { "name": "melanosome membrane", "id": "GO:0033162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033162", "evidence": [ { "database": "UniProtKB", "id": "Q99P91", "url": "https://www.uniprot.org/uniprot/Q99P91" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 134, "end_pos": 136, "annotation": "n_glycosylation_sequon" }, { "start_pos": 200, "end_pos": 202, "annotation": "n_glycosylation_sequon" }, { "start_pos": 249, "end_pos": 251, "annotation": "n_glycosylation_sequon" }, { "start_pos": 275, "end_pos": 277, "annotation": "n_glycosylation_sequon" }, { "start_pos": 296, "end_pos": 298, "annotation": "n_glycosylation_sequon" }, { "start_pos": 300, "end_pos": 302, "annotation": "n_glycosylation_sequon" }, { "start_pos": 306, "end_pos": 308, "annotation": "n_glycosylation_sequon" }, { "start_pos": 312, "end_pos": 314, "annotation": "n_glycosylation_sequon" }, { "start_pos": 463, "end_pos": 465, "annotation": "n_glycosylation_sequon" }, { "start_pos": 471, "end_pos": 473, "annotation": "n_glycosylation_sequon" }, { "start_pos": 93, "end_pos": 95, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 11 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 11 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }