{ "uniprot_canonical_ac": "Q99MA0-1", "uniprot_ac": "Q99MA0", "uniprot_id": "CITE4_RAT", "mass": { "chemical_mass": 18158.0, "monoisotopic_mass": 18158.0 }, "refseq": { "ac": "NP_446151", "name": "cbp/p300-interacting transactivator 4", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446151" }, "gene_names": [ { "name": "Cited4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/Q99MA0", "id": "Q99MA0" }, { "name": "Cited4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446151", "id": "NP_446151" }, { "name": "MRG-2; Mrg2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446151", "id": "NP_446151" }, { "name": "Mrg2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/Q99MA0", "id": "Q99MA0" } ], "protein_names": [ { "name": "Cbp/p300-interacting transactivator 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "Q99MA0" }, { "name": "MRG-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99MA0" }, { "name": "MSG1-related protein 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446151", "id": "NP_446151" }, { "name": "MSG1-related protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "Q99MA0" }, { "name": "cbp/p300-interacting transactivator 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446151", "id": "NP_446151" } ], "function": [ { "annotation": "Acts as transcriptional coactivator for TFAP2/AP-2. Enhances estrogen-dependent transactivation mediated by estrogen receptors. May function as an inhibitor of transactivation by HIF1A by disrupting HIF1A interaction with CREBBP. May be involved in regulation of gene expression during development and differentiation of blood cells, endothelial cells and mammary epithelial cells (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q99MA0", "url": "https://www.uniprot.org/uniprot/Q99MA0#function" } ] }, { "annotation": "Cited4 expression follows a 24-hour pattern in the rat pineal gland in which night levels are 100-fold higher than day levels. This increase is driven by norepinephrine-cyclic AMP signaling.", "evidence": [ { "database": "RefSeq", "id": "NP_446151", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446151" }, { "database": "PubMed", "id": "19103603", "url": "https://glygen.org/publication/PubMed/19103603" } ] }, { "annotation": "Phenotypic screen quantifying differential regulation of cardiac myocyte hypertrophy identifies CITED4 regulation of myocyte elongation.", "evidence": [ { "database": "RefSeq", "id": "NP_446151", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446151" }, { "database": "PubMed", "id": "24613264", "url": "https://glygen.org/publication/PubMed/24613264" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "Q99MA0", "url": "https://www.uniprot.org/uniprot/Q99MA0" } ], "common_name": "Rat" } ], "gene": [ { "name": "Cited4", "url": "https://www.uniprot.org/uniprot/Q99MA0", "locus": { "chromosome": "5", "start_pos": 134248135, "end_pos": 134246682, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000046607", "url": "https://www.ensembl.org/id/ENSRNOG00000046607" } ] } } ], "crossref": [ { "id": "ENSRNOG00000046607", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000046607", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "114491", "url": "https://www.ncbi.nlm.nih.gov/gene/114491", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR007576", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007576", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:114491", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:114491", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GYHLVQR", "url": "https://omabrowser.org/oma/group/GYHLVQR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4213331at2759", "url": "http://www.orthodb.org/?query=4213331at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR17045", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17045", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR17045:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17045:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04487", "url": "http://pfam.xfam.org/family/PF04487", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_Q99MA0", "url": "http://purl.obolibrary.org/obo/PR_Q99MA0", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_446151", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446151", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "620113", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=620113", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "Q99MA0", "url": "https://www.uniprot.org/uniprot/Q99MA0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q99MA0-1", "url": "https://www.uniprot.org/uniprot/Q99MA0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MADHLMLAEGYCLLQVPHAPRTLQPYPGPGLDSGLRPRGAPLGPPPPSGTLAYGSFGSPVSFQPFPVSQPPGAGNAHLQSAATPSPGRMPAPPSAAGGPSPLQPAPGAASPLPLPPPPPLPPALGCMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSVPAAGSVSC", "length": 179, "header": "sp|Q99MA0-1|CITE4_RAT Isoform 1 of Cbp/p300-interacting transactivator 4 OS=Rattus norvegicus OX=10116 GN=Cited4 PE=2 SV=1 CANONICAL=Q99MA0-1" }, "isoforms": [ { "isoform_ac": "Q99MA0-1", "url": "", "sequence": { "sequence": "MADHLMLAEGYCLLQVPHAPRTLQPYPGPGLDSGLRPRGAPLGPPPPSGTLAYGSFGSPVSFQPFPVSQPPGAGNAHLQSAATPSPGRMPAPPSAAGGPSPLQPAPGAASPLPLPPPPPLPPALGCMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSVPAAGSVSC", "length": 179, "header": "sp|Q99MA0-1|CITE4_RAT Isoform 1 of Cbp/p300-interacting transactivator 4 OS=Rattus norvegicus OX=10116 GN=Cited4 PE=2 SV=1 CANONICAL=Q99MA0-1" }, "locus": { "chromosome": "5", "start_pos": 134247675, "end_pos": 134247139, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000072427", "url": "https://www.ensembl.org/id/ENSRNOT00000072427" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000064826", "url": "https://www.ensembl.org/id/ENSRNOP00000064826" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Night/day changes in pineal expression of >600 genes: central role of adrenergic/cAMP signaling.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Bailey MJ, Coon SL, Carter DA, Humphries A, Kim JS, Shi Q, Gaildrat P, Morin F, Ganguly S, Hogenesch JB, Weller JL, Rath MF, Moller M, Baler R, Sugden D, Rangel ZG, Munson PJ, Klein DC", "evidence": [ { "database": "RefSeq", "id": "NP_446151", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446151" } ], "reference": [ { "type": "PubMed", "id": "19103603", "url": "https://glygen.org/publication/PubMed/19103603" } ] }, { "title": "Phenotypic screen quantifying differential regulation of cardiac myocyte hypertrophy identifies CITED4 regulation of myocyte elongation.", "journal": "Journal of molecular and cellular cardiology", "date": "2014", "authors": "Ryall KA, Bezzerides VJ, Rosenzweig A, Saucerman JJ", "evidence": [ { "database": "RefSeq", "id": "NP_446151", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_446151" } ], "reference": [ { "type": "PubMed", "id": "24613264", "url": "https://glygen.org/publication/PubMed/24613264" } ] } ], "pathway": [ { "id": "rno:114491", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:114491", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q96RK1-1", "protein_name": "Cbp/p300-interacting transactivator 4", "gene_name": "CITED4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MADHLMLAEGYRLVQRPPSAAAAHGPHALRTLPPYAGPGLDSGLRPRGAPLGPPPPRQPGALAYGAFGPPSSFQPFPAVPPPAAGIAHLQPVATPYPGRAAAPPNAPGGPPGPQPAPSAAAPPPPAHALGGMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC", "length": 184 }, "evidence": [ { "id": "45228514", "url": "http://www.informatics.jax.org/homology/45228514", "database": "MGI" }, { "id": "Q99MA0", "url": "https://omabrowser.org/oma/group/Q99MA0/", "database": "OMA" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9WUL8-1", "protein_name": "Cbp/p300-interacting transactivator 4", "gene_name": "Cited4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MADHLMLAEGYCLLQVPPHTHGPHAPRTLQPYAGPGMDSGLRPRGAPLGPPPPPGTLAYGSFGSPVSFQPFPVSQSPGAGSTHLQSAATPSPGRIPAPPAAAGGPSPLQPAPGAAASLPPPPPPPALGCMDTELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPAAGSVSC", "length": 182 }, "evidence": [ { "id": "45228514", "url": "http://www.informatics.jax.org/homology/45228514", "database": "MGI" }, { "id": "Q99MA0", "url": "https://omabrowser.org/oma/group/Q99MA0/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "Q99MA0", "url": "https://www.uniprot.org/uniprot/Q99MA0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "Q99MA0", "url": "https://www.uniprot.org/uniprot/Q99MA0" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "Q99MA0", "url": "https://www.uniprot.org/uniprot/Q99MA0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "Q99MA0", "url": "https://www.uniprot.org/uniprot/Q99MA0" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "Q99MA0", "url": "https://www.uniprot.org/uniprot/Q99MA0" } ], "pmid": "" }, { "name": "response to estrogen", "id": "GO:0043627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043627", "evidence": [ { "database": "UniProtKB", "id": "Q99MA0", "url": "https://www.uniprot.org/uniprot/Q99MA0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }